MG_438_MONOMER – type I restriction modification DNA specificity domain protein

Name
WID	MG_438_MONOMER
Name	type I restriction modification DNA specificity domain protein
Cross references	PDB: 1YDX

Genetics
Gene	MG_438

Structure
Sequence	1 51 101 151 201 251 301 351 MTPKLKLNNNINWTKRTIDSLFDLKKGEMLEKELITPEGKYEYFNGGVKN SGRTDKFNTFKNTISVIVGGSCGYVRLADKNFFCGQSNCTLNLLDPLELD LKFAYYALKSQQERIEALAFGTTIQNIRISDLKELEIPFTSNKNEQHAIA NTLSVFDERLENLASLIEINRKLRDEYAHKLFSLDEAFLSHWKLEALQSQ MHEITLGEIFNFKSGKYLKSEERLEEGKFPYYGAGIDNTGFVAEPNTEKD TISIISNGYSLGNIRYHEIPWFNGTGSIALEPMNNEIYVPFFYCALKYLQ KDIKERMKSDDSPFLSLKLAGEIKVPYVKSFQLQRKAGKIVFLLDQKLDQ YKKELSSLTVIRDTLLKKLFPDMTERTKSIKDY* 50 100 150 200 250 300 350 384
Is N‑terminal methionine cleaved	No
Prosthetic groups	(None) MG [c]
DNA footprint	Length: 14 (nt), Binding: dsDNA, Region: dsDNA
Empirical formula (pH 7.5)	H₃₁₃₁C₂₀₀₀N₅₁₄O₅₈₉S₁₀
Molecular weight (pH 7.5; Da)	44120.88
Extinction coefficient (260 nm, 25C, pH 7.0)	42330
Instability index	30.50
Is stable	True
Aliphatic index	87.89
GRAVY (25C, pH 7.0)	-0.436
Half life (OD (600 nm) = 0.3, M9 media, 36C; min)	1200

Synthesis
Localization	c

Function
Enzyme	EcoD DNA restriction/modification, DNA base methylation (adenine ==> 6-methyladenine; S-Adenosyl-L-methionine) [c]: AD + AMET ⇒ AHCYS + H + m6AD EcoD DNA restriction/modification, DNA restriction [c]: ATP + (2) dRibose5P_dRibose5P + (3) H2O ⇒ ADP + (4) DR5P + (3) H + PI
Reaction participant	DNA bound protein release (type I restriction modification DNA specificity domain protein releases topoisomerase IV) MG_203_204_TETRAMER[d] + MG_438_MONOMER[c] ⇒ MG_203_204_TETRAMER[c] + MG_438_MONOMER[d] DNA bound protein release (polI-like 5'-3' exonuclease, putative releases type I restriction modification DNA specificity domain protein) MG_262_MONOMER[c] + MG_438_MONOMER[d] ⇒ MG_262_MONOMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA 7mer-(6)ATP-(1)ADP) MG_438_MONOMER[c] + MG_469_7MER_6ATP_ADP[d] ⇒ MG_438_MONOMER[d] + MG_469_7MER_6ATP_ADP[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA-ATP 6mer) MG_438_MONOMER[c] + MG_469_6MER_ATP[d] ⇒ MG_438_MONOMER[d] + MG_469_6MER_ATP[c] DNA bound protein release (DNA-directed RNA polymerase releases type I restriction modification DNA specificity domain protein) MG_438_MONOMER[d] + RNA_POLYMERASE[c] ⇒ MG_438_MONOMER[c] + RNA_POLYMERASE[d] ... 44 more DNA bound protein release (3-5' helicase releases type I restriction modification DNA specificity domain protein) MG_244_DIMER[c] + MG_438_MONOMER[d] ⇒ MG_244_DIMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases Uncharacterized HTH-type transcriptional regulator) MG_101_MONOMER[d] + MG_438_MONOMER[c] ⇒ MG_101_MONOMER[c] + MG_438_MONOMER[d] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA 3mer-(2)ATP-(1)ADP) MG_438_MONOMER[c] + MG_469_3MER_2ATP_ADP[d] ⇒ MG_438_MONOMER[d] + MG_469_3MER_2ATP_ADP[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DNA-directed RNA polymerase holoenzyme) MG_438_MONOMER[c] + RNA_POLYMERASE_HOLOENZYME[d] ⇒ MG_438_MONOMER[d] + RNA_POLYMERASE_HOLOENZYME[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA-ATP 5mer) MG_438_MONOMER[c] + MG_469_5MER_ATP[d] ⇒ MG_438_MONOMER[d] + MG_469_5MER_ATP[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases Spx subfamily protein) MG_127_MONOMER[d] + MG_438_MONOMER[c] ⇒ MG_127_MONOMER[c] + MG_438_MONOMER[d] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DNA gyrase) DNA_GYRASE[d] + MG_438_MONOMER[c] ⇒ DNA_GYRASE[c] + MG_438_MONOMER[d] DNA bound protein release (DNA polymerase (2) core, β-clamp, γ-complex, and primase releases type I restriction modification DNA specificity domain protein) DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[c] + MG_438_MONOMER[d] ⇒ DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA-ATP) MG_438_MONOMER[c] + MG_469_1MER_ATP[d] ⇒ MG_438_MONOMER[d] + MG_469_1MER_ATP[c] DNA bound protein release (recombination protein, strand exchange releases type I restriction modification DNA specificity domain protein) MG_339_MONOMER[c] + MG_438_MONOMER[d] ⇒ MG_339_MONOMER[d] + MG_438_MONOMER[c] DNA bound protein release (DNA polymerase core, β-clamp, and primase releases type I restriction modification DNA specificity domain protein) DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[c] + MG_438_MONOMER[d] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA-ATP 7mer) MG_438_MONOMER[c] + MG_469_7MER_ATP[d] ⇒ MG_438_MONOMER[d] + MG_469_7MER_ATP[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA 2mer-(1)ATP-(1)ADP) MG_438_MONOMER[c] + MG_469_2MER_1ATP_ADP[d] ⇒ MG_438_MONOMER[d] + MG_469_2MER_1ATP_ADP[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases single-strand binding protein family, octamer) MG_091_OCTAMER[d] + MG_438_MONOMER[c] ⇒ MG_091_OCTAMER[c] + MG_438_MONOMER[d] DNA bound protein release (DNA polymerase III, beta subunit releases type I restriction modification DNA specificity domain protein) MG_001_MONOMER[c] + MG_438_MONOMER[d] ⇒ MG_001_MONOMER[d] + MG_438_MONOMER[c] DNA bound protein release (DNA polymerase core, β-clamp, and γ-complex releases type I restriction modification DNA specificity domain protein) DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[c] + MG_438_MONOMER[d] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA-ATP 4mer) MG_438_MONOMER[c] + MG_469_4MER_ATP[d] ⇒ MG_438_MONOMER[d] + MG_469_4MER_ATP[c] DNA bound protein release (replicative DNA helicase releases type I restriction modification DNA specificity domain protein) MG_094_HEXAMER[c] + MG_438_MONOMER[d] ⇒ MG_094_HEXAMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases LuxR bacterial regulatory protein, putative) MG_428_DIMER[d] + MG_438_MONOMER[c] ⇒ MG_428_DIMER[c] + MG_438_MONOMER[d] DNA bound protein release (DNA polymerase III, beta clamp releases type I restriction modification DNA specificity domain protein) MG_001_DIMER[c] + MG_438_MONOMER[d] ⇒ MG_001_DIMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases Chromosome Segregation Protein SMC with SCP Proteins-ADP) MG_213_214_298_6MER_ADP[d] + MG_438_MONOMER[c] ⇒ MG_213_214_298_6MER_ADP[c] + MG_438_MONOMER[d] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA 6mer-(5)ATP-(1)ADP) MG_438_MONOMER[c] + MG_469_6MER_5ATP_ADP[d] ⇒ MG_438_MONOMER[d] + MG_469_6MER_5ATP_ADP[c] DNA bound protein release (DNA incision complex releases type I restriction modification DNA specificity domain protein) MG_073_206_421_TETRAMER[c] + MG_438_MONOMER[d] ⇒ MG_073_206_421_TETRAMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DNA topoisomerase I) MG_122_MONOMER[d] + MG_438_MONOMER[c] ⇒ MG_122_MONOMER[c] + MG_438_MONOMER[d] DNA bound protein release (apurinic endonuclease releases type I restriction modification DNA specificity domain protein) MG_235_MONOMER[c] + MG_438_MONOMER[d] ⇒ MG_235_MONOMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA-ATP 3mer) MG_438_MONOMER[c] + MG_469_3MER_ATP[d] ⇒ MG_438_MONOMER[d] + MG_469_3MER_ATP[c] DNA bound protein release (Holliday junction DNA helicase releases type I restriction modification DNA specificity domain protein) MG_358_359_10MER[c] + MG_438_MONOMER[d] ⇒ MG_358_359_10MER[d] + MG_438_MONOMER[c] DNA bound protein release (DNA ligase, NAD-dependent releases type I restriction modification DNA specificity domain protein) MG_254_MONOMER[c] + MG_438_MONOMER[d] ⇒ MG_254_MONOMER[d] + MG_438_MONOMER[c] DNA bound protein release (Holliday junction endonuclease releases type I restriction modification DNA specificity domain protein) MG_352_DIMER[c] + MG_438_MONOMER[d] ⇒ MG_352_DIMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases putative DNA integrity scanning protein) MG_105_OCTAMER[d] + MG_438_MONOMER[c] ⇒ MG_105_OCTAMER[c] + MG_438_MONOMER[d] DNA bound protein release (adenine-specific DNA modification methylase releases type I restriction modification DNA specificity domain protein) MG_184_DIMER[c] + MG_438_MONOMER[d] ⇒ MG_184_DIMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DNA ligase, NAD-dependent) MG_254_MONOMER[d] + MG_438_MONOMER[c] ⇒ MG_254_MONOMER[c] + MG_438_MONOMER[d] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA 4mer-(3)ATP-(1)ADP) MG_438_MONOMER[c] + MG_469_4MER_3ATP_ADP[d] ⇒ MG_438_MONOMER[d] + MG_469_4MER_3ATP_ADP[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases ferric uptake repressor) MG_236_MONOMER[d] + MG_438_MONOMER[c] ⇒ MG_236_MONOMER[c] + MG_438_MONOMER[d] DNA bound protein release (putative DNA integrity scanning protein releases type I restriction modification DNA specificity domain protein) MG_105_OCTAMER[c] + MG_438_MONOMER[d] ⇒ MG_105_OCTAMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases heat-inducible transcription repressor HrcA, putative) MG_205_DIMER[d] + MG_438_MONOMER[c] ⇒ MG_205_DIMER[c] + MG_438_MONOMER[d] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA-ATP 2mer) MG_438_MONOMER[c] + MG_469_2MER_ATP[d] ⇒ MG_438_MONOMER[d] + MG_469_2MER_ATP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases type I restriction modification DNA specificity domain protein) MG_097_MONOMER[c] + MG_438_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_438_MONOMER[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA 5mer-(4)ATP-(1)ADP) MG_438_MONOMER[c] + MG_469_5MER_4ATP_ADP[d] ⇒ MG_438_MONOMER[d] + MG_469_5MER_4ATP_ADP[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DNA-directed RNA polymerase) MG_438_MONOMER[c] + RNA_POLYMERASE[d] ⇒ MG_438_MONOMER[d] + RNA_POLYMERASE[c] DNA bound protein release (type I restriction modification DNA specificity domain protein releases adenine-specific DNA modification methylase) MG_184_DIMER[d] + MG_438_MONOMER[c] ⇒ MG_184_DIMER[c] + MG_438_MONOMER[d] DNA bound protein release (formamidopyrimidine-DNA glycosylase releases type I restriction modification DNA specificity domain protein) MG_438_MONOMER[d] + MG_498_MONOMER[c] ⇒ MG_438_MONOMER[c] + MG_498_MONOMER[d] DNA bound protein release (DNA-directed RNA polymerase holoenzyme releases type I restriction modification DNA specificity domain protein) MG_438_MONOMER[d] + RNA_POLYMERASE_HOLOENZYME[c] ⇒ MG_438_MONOMER[c] + RNA_POLYMERASE_HOLOENZYME[d] DNA bound protein release (type I restriction modification DNA specificity domain protein releases DnaA-ADP) MG_438_MONOMER[c] + MG_469_1MER_ADP[d] ⇒ MG_438_MONOMER[d] + MG_469_1MER_ADP[c]

Parameters
Parameters	Parameter_0057: RM_EcoD_MethylationPosition = 3 b Parameter_0058: RM_EcoD_RecognitionSequence = TTANNNNNNNGTCY dimensionless Parameter_0059: RM_EcoD_RestrictionPosition = b

Comments
Comments	Functional Macromolecule Functional as monomer [PUB_0097]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group. Stable modifications Phosphorylation observed by mass-spec [PUB_0094]. DNA-binding Consensus motif TTANNNNNNNGTCY is 14 bp [PUB_0542].
References	Calisto BM, Pich OQ, Piñol J, Fita I, Querol E, Carpena X. Crystal structure of a putative type I restriction-modification S subunit from Mycoplasma genitalium. J Mol Biol 351, 749-62 (2005). WholeCell: PUB_0097, PubMed: 16038930 Murray NE. Type I restriction systems: sophisticated molecular machines (a legacy of Bertani and Weigle). Microbiol Mol Biol Rev 64, 412-34 (2000). WholeCell: PUB_0542, PubMed: 10839821 Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

Metadata
Created	2012-10-01 15:08:03
Last updated	2012-10-01 15:14:50