MG_236_MONOMER – ferric uptake repressor

Name
WID	MG_236_MONOMER
Name	ferric uptake repressor

Genetics
Gene	MG_236

Structure
Sequence	1 51 101 MLTSYVKVLEQNNLRLTKPRIALLKCLIEHQDWHNLSQIKTHLDLANQPS TLASIYNNLRILAKLKLINIFVDPERFETYYCLRHAEHNHIYLFDEVKQQ FFTLPLTDGQIKTLLETQNHTSKVKLNDFYIVARGEINND* 50 100 141
Is N‑terminal methionine cleaved	No
DNA footprint	Length: 36 (nt), Binding: dsDNA, Region: dsDNA
Empirical formula (pH 7.5)	H₁₁₈₂C₇₅₀N₂₀₃O₂₁₂S₃
Molecular weight (pH 7.5; Da)	16530.79
Extinction coefficient (260 nm, 25C, pH 7.0)	14690
Instability index	38.06
Is stable	True
Aliphatic index	107.87
GRAVY (25C, pH 7.0)	-0.319
Half life (OD (600 nm) = 0.3, M9 media, 36C; min)	1200

Synthesis
Localization	c

Regulation
Regulatory rule	stimulus_ironStress

Function
Transcriptional regulation	TranscriptionalRegulation_fur_TU_008: TU_008 TranscriptionalRegulation_fur_TU_016: TU_016 TranscriptionalRegulation_fur_TU_085: TU_085 TranscriptionalRegulation_fur_TU_097: TU_097 TranscriptionalRegulation_fur_TU_196: TU_196 ... 3 more TranscriptionalRegulation_fur_TU_207: TU_207 TranscriptionalRegulation_fur_TU_222: TU_222 TranscriptionalRegulation_fur_TU_249: TU_249
Reaction participant	DNA bound protein release (3-5' helicase releases ferric uptake repressor) MG_236_MONOMER[d] + MG_244_DIMER[c] ⇒ MG_236_MONOMER[c] + MG_244_DIMER[d] DNA bound protein release (ferric uptake repressor releases DnaA-ATP) MG_236_MONOMER[c] + MG_469_1MER_ATP[d] ⇒ MG_236_MONOMER[d] + MG_469_1MER_ATP[c] DNA bound protein release (ferric uptake repressor releases topoisomerase IV) MG_203_204_TETRAMER[d] + MG_236_MONOMER[c] ⇒ MG_203_204_TETRAMER[c] + MG_236_MONOMER[d] DNA bound protein release (DNA polymerase III, beta clamp releases ferric uptake repressor) MG_001_DIMER[c] + MG_236_MONOMER[d] ⇒ MG_001_DIMER[d] + MG_236_MONOMER[c] DNA bound protein release (replicative DNA helicase releases ferric uptake repressor) MG_094_HEXAMER[c] + MG_236_MONOMER[d] ⇒ MG_094_HEXAMER[d] + MG_236_MONOMER[c] ... 22 more DNA bound protein release (apurinic endonuclease releases ferric uptake repressor) MG_235_MONOMER[c] + MG_236_MONOMER[d] ⇒ MG_235_MONOMER[d] + MG_236_MONOMER[c] DNA bound protein release (ferric uptake repressor releases DnaA-ADP) MG_236_MONOMER[c] + MG_469_1MER_ADP[d] ⇒ MG_236_MONOMER[d] + MG_469_1MER_ADP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases ferric uptake repressor) MG_097_MONOMER[c] + MG_236_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_236_MONOMER[c] DNA bound protein release (ferric uptake repressor releases DNA topoisomerase I) MG_122_MONOMER[d] + MG_236_MONOMER[c] ⇒ MG_122_MONOMER[c] + MG_236_MONOMER[d] DNA bound protein release (DNA-directed RNA polymerase holoenzyme releases ferric uptake repressor) MG_236_MONOMER[d] + RNA_POLYMERASE_HOLOENZYME[c] ⇒ MG_236_MONOMER[c] + RNA_POLYMERASE_HOLOENZYME[d] DNA bound protein release (DNA polymerase core, β-clamp, and γ-complex releases ferric uptake repressor) DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[c] + MG_236_MONOMER[d] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[d] + MG_236_MONOMER[c] DNA bound protein release (DNA polymerase core, β-clamp, and primase releases ferric uptake repressor) DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[c] + MG_236_MONOMER[d] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[d] + MG_236_MONOMER[c] DNA bound protein release (Holliday junction DNA helicase releases ferric uptake repressor) MG_236_MONOMER[d] + MG_358_359_10MER[c] ⇒ MG_236_MONOMER[c] + MG_358_359_10MER[d] DNA bound protein release (DNA incision complex releases ferric uptake repressor) MG_073_206_421_TETRAMER[c] + MG_236_MONOMER[d] ⇒ MG_073_206_421_TETRAMER[d] + MG_236_MONOMER[c] DNA bound protein release (DNA polymerase (2) core, β-clamp, γ-complex, and primase releases ferric uptake repressor) DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[c] + MG_236_MONOMER[d] ⇒ DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[d] + MG_236_MONOMER[c] DNA bound protein release (ferric uptake repressor releases DNA gyrase) DNA_GYRASE[d] + MG_236_MONOMER[c] ⇒ DNA_GYRASE[c] + MG_236_MONOMER[d] DNA bound protein release (formamidopyrimidine-DNA glycosylase releases ferric uptake repressor) MG_236_MONOMER[d] + MG_498_MONOMER[c] ⇒ MG_236_MONOMER[c] + MG_498_MONOMER[d] DNA bound protein release (putative DNA integrity scanning protein releases ferric uptake repressor) MG_105_OCTAMER[c] + MG_236_MONOMER[d] ⇒ MG_105_OCTAMER[d] + MG_236_MONOMER[c] DNA bound protein release (Holliday junction endonuclease releases ferric uptake repressor) MG_236_MONOMER[d] + MG_352_DIMER[c] ⇒ MG_236_MONOMER[c] + MG_352_DIMER[d] DNA bound protein release (DNA-directed RNA polymerase releases ferric uptake repressor) MG_236_MONOMER[d] + RNA_POLYMERASE[c] ⇒ MG_236_MONOMER[c] + RNA_POLYMERASE[d] DNA bound protein release (recombination protein, strand exchange releases ferric uptake repressor) MG_236_MONOMER[d] + MG_339_MONOMER[c] ⇒ MG_236_MONOMER[c] + MG_339_MONOMER[d] DNA bound protein release (type I restriction modification DNA specificity domain protein releases ferric uptake repressor) MG_236_MONOMER[d] + MG_438_MONOMER[c] ⇒ MG_236_MONOMER[c] + MG_438_MONOMER[d] DNA bound protein release (DNA polymerase III, beta subunit releases ferric uptake repressor) MG_001_MONOMER[c] + MG_236_MONOMER[d] ⇒ MG_001_MONOMER[d] + MG_236_MONOMER[c] DNA bound protein release (adenine-specific DNA modification methylase releases ferric uptake repressor) MG_184_DIMER[c] + MG_236_MONOMER[d] ⇒ MG_184_DIMER[d] + MG_236_MONOMER[c] DNA bound protein release (polI-like 5'-3' exonuclease, putative releases ferric uptake repressor) MG_236_MONOMER[d] + MG_262_MONOMER[c] ⇒ MG_236_MONOMER[c] + MG_262_MONOMER[d] DNA bound protein release (DNA ligase, NAD-dependent releases ferric uptake repressor) MG_236_MONOMER[d] + MG_254_MONOMER[c] ⇒ MG_236_MONOMER[c] + MG_254_MONOMER[d] DNA bound protein release (ferric uptake repressor releases Chromosome Segregation Protein SMC with SCP Proteins-ADP) MG_213_214_298_6MER_ADP[d] + MG_236_MONOMER[c] ⇒ MG_213_214_298_6MER_ADP[c] + MG_236_MONOMER[d]

Comments
Comments	Consensus sequence GATAATGATAATCATTATC is 19 bp [PUB_0418, PUB_0419, PUB_0438]. Dnase I footprint is 14-28 nt [PUB_0731], 31 nt [PUB_0730, PUB_0732], 36 nt [PUB_0729]; extending to 50-55 at higher fur concentrations [PUB_0729, PUB_0732]. Regulation Activated by iron stress [PUB_0418, PUB_0419, PUB_0438].
References	Althaus EW, Outten CE, Olson KE, Cao H, O'Halloran TV. The ferric uptake regulation (Fur) repressor is a zinc metalloprotein. Biochemistry 38, 6559-69 (1999). WholeCell: PUB_0731, PubMed: 10350474 Baichoo N, Wang T, Ye R, Helmann JD. Global analysis of the Bacillus subtilis Fur regulon and the iron starvation stimulon. Mol Microbiol 45, 1613-29 (2002). WholeCell: PUB_0438, PubMed: 12354229 Güell M, van Noort V, Yus E, Chen WH, Leigh-Bell J, Michalodimitrakis K, Yamada T, Arumugam M, Doerks T, Kühner S, Rode M, Suyama M, Schmidt S, Gavin AC, Bork P, Serrano L. Transcriptome complexity in a genome-reduced bacterium. Science 326, 1268-71 (2009). WholeCell: PUB_0418, PubMed: 19965477 Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic Acids Res 36, D93-6 (2008). WholeCell: PUB_0419, PubMed: 17962296, URL: http://dbtbs.hgc.jp/ Tardat B, Touati D. Iron and oxygen regulation of Escherichia coli MnSOD expression: competition between the global regulators Fur and ArcA for binding to DNA. Mol Microbiol 9, 53-63 (1993). WholeCell: PUB_0729, PubMed: 8412671 ... 2 more de Lorenzo V, Giovannini F, Herrero M, Neilands JB. Metal ion regulation of gene expression. Fur repressor-operator interaction at the promoter region of the aerobactin system of pColV-K30. J Mol Biol 203, 875-84 (1988). WholeCell: PUB_0732, PubMed: 3062182 de Lorenzo V, Wee S, Herrero M, Neilands JB. Operator sequences of the aerobactin operon of plasmid ColV-K30 binding the ferric uptake regulation (fur) repressor. J Bacteriol 169, 2624-30 (1987). WholeCell: PUB_0730, PubMed: 3294800

Metadata
Created	2012-10-01 15:07:54
Last updated	2012-10-01 15:14:36