MG_127_MONOMER – Spx subfamily protein

Name
WID	MG_127_MONOMER
Name	Spx subfamily protein

Genetics
Gene	MG_127

Structure
Sequence	1 51 101 MKKAGKKNSDAGKTFILISSSCSSCQKAIEFFDQNKISYVVENFYKKPIS DKRFKDILSLSEDGTESLFSKRADQIKATNSVSVEELSISELIKLVRERP SLLRRPIIIQYNSSGIPKRMRIGYNSSEIKVFERKLIEPKPIIQQ* 50 100 146
Is N‑terminal methionine cleaved	No
Disulfide_bonds	MG_127_MONOMER_ox: 22-25
DNA footprint	Length: 25 (nt), Binding: dsDNA, Region: dsDNA
Empirical formula (pH 7.5)	H₁₂₂₂C₇₃₉N₂₀₂O₂₂₀S₄
Molecular weight (pH 7.5; Da)	16585.04
Extinction coefficient (260 nm, 25C, pH 7.0)	6210
Instability index	51.12
Is stable	False
Aliphatic index	90.14
GRAVY (25C, pH 7.0)	-0.454
Half life (OD (600 nm) = 0.3, M9 media, 36C; min)	1200

Synthesis
Localization	c

Regulation
Regulatory rule	stimulus_thiolStress

Function
Transcriptional regulation	TranscriptionalRegulation_spx_TU_008: TU_008 TranscriptionalRegulation_spx_TU_014: TU_014 TranscriptionalRegulation_spx_TU_030: TU_030 TranscriptionalRegulation_spx_TU_051: TU_051 TranscriptionalRegulation_spx_TU_063: TU_063 ... 8 more TranscriptionalRegulation_spx_TU_074: TU_074 TranscriptionalRegulation_spx_TU_076: TU_076 TranscriptionalRegulation_spx_TU_113: TU_113 TranscriptionalRegulation_spx_TU_180: TU_180 TranscriptionalRegulation_spx_TU_190: TU_190 TranscriptionalRegulation_spx_TU_198: TU_198 TranscriptionalRegulation_spx_TU_207: TU_207 TranscriptionalRegulation_spx_TU_326: TU_326
Reaction participant	DNA bound protein release (apurinic endonuclease releases Spx subfamily protein) MG_127_MONOMER[d] + MG_235_MONOMER[c] ⇒ MG_127_MONOMER[c] + MG_235_MONOMER[d] DNA bound protein release (Holliday junction endonuclease releases Spx subfamily protein) MG_127_MONOMER[d] + MG_352_DIMER[c] ⇒ MG_127_MONOMER[c] + MG_352_DIMER[d] DNA bound protein release (Spx subfamily protein releases DnaA-ADP) MG_127_MONOMER[c] + MG_469_1MER_ADP[d] ⇒ MG_127_MONOMER[d] + MG_469_1MER_ADP[c] DNA bound protein release (DNA polymerase core, β-clamp, and γ-complex releases Spx subfamily protein) DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[c] + MG_127_MONOMER[d] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[d] + MG_127_MONOMER[c] DNA bound protein release (DNA incision complex releases Spx subfamily protein) MG_073_206_421_TETRAMER[c] + MG_127_MONOMER[d] ⇒ MG_073_206_421_TETRAMER[d] + MG_127_MONOMER[c] ... 22 more DNA bound protein release (DNA polymerase III, beta clamp releases Spx subfamily protein) MG_001_DIMER[c] + MG_127_MONOMER[d] ⇒ MG_001_DIMER[d] + MG_127_MONOMER[c] DNA bound protein release (DNA ligase, NAD-dependent releases Spx subfamily protein) MG_127_MONOMER[d] + MG_254_MONOMER[c] ⇒ MG_127_MONOMER[c] + MG_254_MONOMER[d] DNA bound protein release (type I restriction modification DNA specificity domain protein releases Spx subfamily protein) MG_127_MONOMER[d] + MG_438_MONOMER[c] ⇒ MG_127_MONOMER[c] + MG_438_MONOMER[d] DNA bound protein release (Holliday junction DNA helicase releases Spx subfamily protein) MG_127_MONOMER[d] + MG_358_359_10MER[c] ⇒ MG_127_MONOMER[c] + MG_358_359_10MER[d] DNA bound protein release (DNA polymerase III, beta subunit releases Spx subfamily protein) MG_001_MONOMER[c] + MG_127_MONOMER[d] ⇒ MG_001_MONOMER[d] + MG_127_MONOMER[c] DNA bound protein release (Spx subfamily protein releases DNA gyrase) DNA_GYRASE[d] + MG_127_MONOMER[c] ⇒ DNA_GYRASE[c] + MG_127_MONOMER[d] DNA bound protein release (3-5' helicase releases Spx subfamily protein) MG_127_MONOMER[d] + MG_244_DIMER[c] ⇒ MG_127_MONOMER[c] + MG_244_DIMER[d] DNA bound protein release (adenine-specific DNA modification methylase releases Spx subfamily protein) MG_127_MONOMER[d] + MG_184_DIMER[c] ⇒ MG_127_MONOMER[c] + MG_184_DIMER[d] DNA bound protein release (putative DNA integrity scanning protein releases Spx subfamily protein) MG_105_OCTAMER[c] + MG_127_MONOMER[d] ⇒ MG_105_OCTAMER[d] + MG_127_MONOMER[c] DNA bound protein release (DNA-directed RNA polymerase releases Spx subfamily protein) MG_127_MONOMER[d] + RNA_POLYMERASE[c] ⇒ MG_127_MONOMER[c] + RNA_POLYMERASE[d] DNA bound protein release (replicative DNA helicase releases Spx subfamily protein) MG_094_HEXAMER[c] + MG_127_MONOMER[d] ⇒ MG_094_HEXAMER[d] + MG_127_MONOMER[c] DNA bound protein release (DNA-directed RNA polymerase holoenzyme releases Spx subfamily protein) MG_127_MONOMER[d] + RNA_POLYMERASE_HOLOENZYME[c] ⇒ MG_127_MONOMER[c] + RNA_POLYMERASE_HOLOENZYME[d] DNA bound protein release (DNA polymerase (2) core, β-clamp, γ-complex, and primase releases Spx subfamily protein) DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[c] + MG_127_MONOMER[d] ⇒ DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[d] + MG_127_MONOMER[c] DNA bound protein release (recombination protein, strand exchange releases Spx subfamily protein) MG_127_MONOMER[d] + MG_339_MONOMER[c] ⇒ MG_127_MONOMER[c] + MG_339_MONOMER[d] DNA bound protein release (polI-like 5'-3' exonuclease, putative releases Spx subfamily protein) MG_127_MONOMER[d] + MG_262_MONOMER[c] ⇒ MG_127_MONOMER[c] + MG_262_MONOMER[d] DNA bound protein release (formamidopyrimidine-DNA glycosylase releases Spx subfamily protein) MG_127_MONOMER[d] + MG_498_MONOMER[c] ⇒ MG_127_MONOMER[c] + MG_498_MONOMER[d] DNA bound protein release (uracil-DNA glycosylase, putative releases Spx subfamily protein) MG_097_MONOMER[c] + MG_127_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_127_MONOMER[c] DNA bound protein release (DNA polymerase core, β-clamp, and primase releases Spx subfamily protein) DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[c] + MG_127_MONOMER[d] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[d] + MG_127_MONOMER[c] DNA bound protein release (Spx subfamily protein releases DnaA-ATP) MG_127_MONOMER[c] + MG_469_1MER_ATP[d] ⇒ MG_127_MONOMER[d] + MG_469_1MER_ATP[c] DNA bound protein release (Spx subfamily protein releases DNA topoisomerase I) MG_122_MONOMER[d] + MG_127_MONOMER[c] ⇒ MG_122_MONOMER[c] + MG_127_MONOMER[d] DNA bound protein release (Spx subfamily protein releases Chromosome Segregation Protein SMC with SCP Proteins-ADP) MG_127_MONOMER[c] + MG_213_214_298_6MER_ADP[d] ⇒ MG_127_MONOMER[d] + MG_213_214_298_6MER_ADP[c] DNA bound protein release (Spx subfamily protein releases topoisomerase IV) MG_127_MONOMER[c] + MG_203_204_TETRAMER[d] ⇒ MG_127_MONOMER[d] + MG_203_204_TETRAMER[c]
Complex subunit	oxidized Spx subfamily protein [c]: MG_127_MONOMER ⇒ (2) H + MG_127_MONOMER_ox

Comments
Comments	Functional Macromolecule Functional as monomer [PUB_0112]. Transcriptional Regulation Affects transcription by interacting solely with RNA polymerase, and does not directly bind DNA [PUB_0434]. Together with RNAP spx has 43-50 nt footprint [PUB_0728]. RNAP and RNAPα alone have footprints of 7 and 25 nt [PUB_0728]. We conclude that spx alone has a footprint of 25 nt [PUB_0728]. Regulation Activated by thiol stress [PUB_0434, PUB_0435, PUB_0436].
References	Choi SY, Reyes D, Leelakriangsak M, Zuber P. The global regulator Spx functions in the control of organosulfur metabolism in Bacillus subtilis. J Bacteriol 188, 5741-51 (2006). WholeCell: PUB_0436, PubMed: 16885442 Erwin KN, Nakano S, Zuber P. Sulfate-dependent repression of genes that function in organosulfur metabolism in Bacillus subtilis requires Spx. J Bacteriol 187, 4042-9 (2005). WholeCell: PUB_0435, PubMed: 15937167 Nakano S, Erwin KN, Ralle M, Zuber P. Redox-sensitive transcriptional control by a thiol/disulphide switch in the global regulator, Spx. Mol Microbiol 55, 498-510 (2005). WholeCell: PUB_0728, PubMed: 15659166 Nakano S, Küster-Schöck E, Grossman AD, Zuber P. Spx-dependent global transcriptional control is induced by thiol-specific oxidative stress in Bacillus subtilis. Proc Natl Acad Sci U S A 100, 13603-8 (2003). WholeCell: PUB_0434, PubMed: 14597697 Newberry KJ, Nakano S, Zuber P, Brennan RG. Crystal structure of the Bacillus subtilis anti-alpha, global transcriptional regulator, Spx, in complex with the alpha C-terminal domain of RNA polymerase. Proc Natl Acad Sci U S A 102, 15839-44 (2005). WholeCell: PUB_0112, PubMed: 16249335

Metadata
Created	2012-10-01 15:07:49
Last updated	2012-10-01 15:14:28