MG_097_MONOMER – uracil-DNA glycosylase, putative

Name
WID	MG_097_MONOMER
Name	uracil-DNA glycosylase, putative
Cross references	PDB: 1LQM, PDB: 5EUG

Genetics
Gene	MG_097

Structure
Sequence	1 51 101 151 201 VVMDDLFQRMVSCVLPSWRAFIDEEVKKPYFQALLEKLKALKATIIPKPE LIFRVFSFFKPIDTKVIIFGQDPYPSPNDACGLAFASNNSKTPASLKRII LRLEKEYPSLKQESSWQQNFLLNWAEQGVLLLNGILTTTVFIRNAHKNWG WEEFNCNLLTFLKNQNIKPLLVFLGVQTKNFVVKSIGNVDGFEHLSYPHP SPLSGNLFLTNPNDLFKTINNWLKQHNQKIINWAVVKNASFDQLS* 50 100 150 200 246
Is N‑terminal methionine cleaved	No
DNA footprint	Length: 9 (nt), Binding: dsDNA, Region: dsDNA
Empirical formula (pH 7.5)	H₂₀₂₂C₁₃₀₈N₃₃₃O₃₅₀S₅
Molecular weight (pH 7.5; Da)	28172.32
Extinction coefficient (260 nm, 25C, pH 7.0)	44835
Instability index	26.36
Is stable	True
Aliphatic index	98.25
GRAVY (25C, pH 7.0)	-0.108
Half life (OD (600 nm) = 0.3, M9 media, 36C; min)	1200

Synthesis
Localization	c

Function
Enzyme	base excision (5-hydroxyuracil) [c]: H2O + ho5dUMP ⇒ DR5P + ho5URA base excision (uracil) [c]: DUMP + H2O ⇒ DR5P + URA
Reaction participant	DNA bound protein release (uracil-DNA glycosylase, putative releases DNA topoisomerase I) MG_097_MONOMER[c] + MG_122_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_122_MONOMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DNA polymerase (2) core, β-clamp, γ-complex, and primase) DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[d] + MG_097_MONOMER[c] ⇒ DNA_POLYMERASE_2CORE_BETA_CLAMP_GAMMA_COMPLEX_PRIMASE[c] + MG_097_MONOMER[d] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA-ATP 7mer) MG_097_MONOMER[c] + MG_469_7MER_ATP[d] ⇒ MG_097_MONOMER[d] + MG_469_7MER_ATP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA 3mer-(2)ATP-(1)ADP) MG_097_MONOMER[c] + MG_469_3MER_2ATP_ADP[d] ⇒ MG_097_MONOMER[d] + MG_469_3MER_2ATP_ADP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA 6mer-(5)ATP-(1)ADP) MG_097_MONOMER[c] + MG_469_6MER_5ATP_ADP[d] ⇒ MG_097_MONOMER[d] + MG_469_6MER_5ATP_ADP[c] ... 30 more DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA 7mer-(6)ATP-(1)ADP) MG_097_MONOMER[c] + MG_469_7MER_6ATP_ADP[d] ⇒ MG_097_MONOMER[d] + MG_469_7MER_6ATP_ADP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DNA polymerase core, β-clamp, and primase) DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[d] + MG_097_MONOMER[c] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_PRIMASE[c] + MG_097_MONOMER[d] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA-ADP) MG_097_MONOMER[c] + MG_469_1MER_ADP[d] ⇒ MG_097_MONOMER[d] + MG_469_1MER_ADP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases ferric uptake repressor) MG_097_MONOMER[c] + MG_236_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_236_MONOMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA-ATP 5mer) MG_097_MONOMER[c] + MG_469_5MER_ATP[d] ⇒ MG_097_MONOMER[d] + MG_469_5MER_ATP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA-ATP 4mer) MG_097_MONOMER[c] + MG_469_4MER_ATP[d] ⇒ MG_097_MONOMER[d] + MG_469_4MER_ATP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA 2mer-(1)ATP-(1)ADP) MG_097_MONOMER[c] + MG_469_2MER_1ATP_ADP[d] ⇒ MG_097_MONOMER[d] + MG_469_2MER_1ATP_ADP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases Uncharacterized HTH-type transcriptional regulator) MG_097_MONOMER[c] + MG_101_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_101_MONOMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA-ATP) MG_097_MONOMER[c] + MG_469_1MER_ATP[d] ⇒ MG_097_MONOMER[d] + MG_469_1MER_ATP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases single-strand binding protein family, octamer) MG_091_OCTAMER[d] + MG_097_MONOMER[c] ⇒ MG_091_OCTAMER[c] + MG_097_MONOMER[d] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA 4mer-(3)ATP-(1)ADP) MG_097_MONOMER[c] + MG_469_4MER_3ATP_ADP[d] ⇒ MG_097_MONOMER[d] + MG_469_4MER_3ATP_ADP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases heat-inducible transcription repressor HrcA, putative) MG_097_MONOMER[c] + MG_205_DIMER[d] ⇒ MG_097_MONOMER[d] + MG_205_DIMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA 5mer-(4)ATP-(1)ADP) MG_097_MONOMER[c] + MG_469_5MER_4ATP_ADP[d] ⇒ MG_097_MONOMER[d] + MG_469_5MER_4ATP_ADP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA-ATP 2mer) MG_097_MONOMER[c] + MG_469_2MER_ATP[d] ⇒ MG_097_MONOMER[d] + MG_469_2MER_ATP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DNA-directed RNA polymerase) MG_097_MONOMER[c] + RNA_POLYMERASE[d] ⇒ MG_097_MONOMER[d] + RNA_POLYMERASE[c] DNA bound protein release (uracil-DNA glycosylase, putative releases adenine-specific DNA modification methylase) MG_097_MONOMER[c] + MG_184_DIMER[d] ⇒ MG_097_MONOMER[d] + MG_184_DIMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DNA-directed RNA polymerase holoenzyme) MG_097_MONOMER[c] + RNA_POLYMERASE_HOLOENZYME[d] ⇒ MG_097_MONOMER[d] + RNA_POLYMERASE_HOLOENZYME[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DNA gyrase) DNA_GYRASE[d] + MG_097_MONOMER[c] ⇒ DNA_GYRASE[c] + MG_097_MONOMER[d] DNA bound protein release (uracil-DNA glycosylase, putative releases DNA ligase, NAD-dependent) MG_097_MONOMER[c] + MG_254_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_254_MONOMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DNA polymerase core, β-clamp, and γ-complex) DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[d] + MG_097_MONOMER[c] ⇒ DNA_POLYMERASE_CORE_BETA_CLAMP_GAMMA_COMPLEX[c] + MG_097_MONOMER[d] DNA bound protein release (uracil-DNA glycosylase, putative releases putative DNA integrity scanning protein) MG_097_MONOMER[c] + MG_105_OCTAMER[d] ⇒ MG_097_MONOMER[d] + MG_105_OCTAMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases topoisomerase IV) MG_097_MONOMER[c] + MG_203_204_TETRAMER[d] ⇒ MG_097_MONOMER[d] + MG_203_204_TETRAMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA-ATP 3mer) MG_097_MONOMER[c] + MG_469_3MER_ATP[d] ⇒ MG_097_MONOMER[d] + MG_469_3MER_ATP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases type I restriction modification DNA specificity domain protein) MG_097_MONOMER[c] + MG_438_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_438_MONOMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases Chromosome Segregation Protein SMC with SCP Proteins-ADP) MG_097_MONOMER[c] + MG_213_214_298_6MER_ADP[d] ⇒ MG_097_MONOMER[d] + MG_213_214_298_6MER_ADP[c] DNA bound protein release (uracil-DNA glycosylase, putative releases replicative DNA helicase) MG_094_HEXAMER[d] + MG_097_MONOMER[c] ⇒ MG_094_HEXAMER[c] + MG_097_MONOMER[d] DNA bound protein release (uracil-DNA glycosylase, putative releases DNA polymerase III, beta clamp) MG_001_DIMER[d] + MG_097_MONOMER[c] ⇒ MG_001_DIMER[c] + MG_097_MONOMER[d] DNA bound protein release (uracil-DNA glycosylase, putative releases Spx subfamily protein) MG_097_MONOMER[c] + MG_127_MONOMER[d] ⇒ MG_097_MONOMER[d] + MG_127_MONOMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases LuxR bacterial regulatory protein, putative) MG_097_MONOMER[c] + MG_428_DIMER[d] ⇒ MG_097_MONOMER[d] + MG_428_DIMER[c] DNA bound protein release (uracil-DNA glycosylase, putative releases DnaA-ATP 6mer) MG_097_MONOMER[c] + MG_469_6MER_ATP[d] ⇒ MG_097_MONOMER[d] + MG_469_6MER_ATP[c]

Comments
Comments	Functional Macromolecule Functional as monomer [PUB_0075]. DNA-binding Fpg footprint is 9 nt [PUB_0719]. Ogg1 footprint is 10 nt [PUB_0719, PUB_0720, PUB_0721, PUB_0722]. Mpg footprint is 12 nt [PUB_0717].
References	Bruner SD, Norman DP, Verdine GL. Structural basis for recognition and repair of the endogenous mutagen 8-oxoguanine in DNA. Nature 403, 859-66 (2000). WholeCell: PUB_0721, PubMed: 10706276 Fromme JC, Bruner SD, Yang W, Karplus M, Verdine GL. Product-assisted catalysis in base-excision DNA repair. Nat Struct Biol 10, 204-11 (2003). WholeCell: PUB_0720, PubMed: 12592398 Miao F, Bouziane M, O'Connor TR. Interaction of the recombinant human methylpurine-DNA glycosylase (MPG protein) with oligodeoxyribonucleotides containing xsDNA hypoxanthine or abasic sites. Nucleic Acids Res 26, 4034-41 (1998). WholeCell: PUB_0717, PubMed: 9705516 Norman DP, Bruner SD, Verdine GL. Coupling of substrate recognition and catalysis by a human base-excision DNA repair protein. J Am Chem Soc 123, 359-60 (2001). WholeCell: PUB_0722, PubMed: 11456534 Sidorenko VS, Zharkov DO. Correlated cleavage of damaged DNA by bacterial and human 8-oxoguanine-DNA glycosylases. Biochemistry 47, 8970-6 (2008). WholeCell: PUB_0719, PubMed: 18672903 Varshney U, Hutcheon T, van de Sande JH. Sequence analysis, expression, and conservation of Escherichia coli uracil DNA glycosylase and its gene (ung). J Biol Chem 263, 7776-84 (1988). WholeCell: PUB_0075, PubMed: 2836397

Metadata
Created	2012-10-01 15:07:47
Last updated	2012-10-01 15:14:26