MG_522_MONOMER – ribosomal protein S20

Name
WID MG_522_MONOMER View in model
Name ribosomal protein S20 View in model
 
Genetics
Gene MG_522 View in model
 
Structure
Sequence
1
51
MANIKSNEKRLRQDIKRNLNNKGQKTKLKTNVKKFNKEINLDNLSSVYSQ
ADRLARKGIISLNRAKRLKSKNAVILHKSNTNSTAKKQ*
50
89
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H776C435N145O129S1
Molecular weight (pH 7.5; Da) 10133.74 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
1490
Instability index 39.33
Is stable True
Aliphatic index 82.25
GRAVY (25C, pH 7.0) -1.12
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 30S ribosomal subunit
[c]: MGrrnA16S + MG_070_MONOMER + MG_087_MONOMER + MG_088_MONOMER + MG_090_MONOMER + MG_092_MONOMER + MG_150_MONOMER + MG_155_MONOMER + MG_157_MONOMER + MG_160_MONOMER + MG_164_MONOMER + MG_165_MONOMER + MG_168_MONOMER + MG_175_MONOMER + MG_176_MONOMER + MG_311_MONOMER + MG_417_MONOMER + MG_424_MONOMER + MG_446_MONOMER + MG_481_MONOMER + MG_522_MONOMERRIBOSOME_30S
View in model
 
Comments
Comments Functional Macromolecule Functional as part of 30S ribosomal particle.
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45