MG_521_MONOMER – membrane protein, putative

Name
WID MG_521_MONOMER View in model
Name membrane protein, putative View in model
 
Genetics
Gene MG_521 View in model
 
Structure
Sequence
1
51
101
151
201
MNGNKLVFLPKKSYHQLFNITFSAMMLALAIITSLISEFISIPFFSQLKL
TFDISVVFLVACAFFVSLGWSLTITLASALTSFFWNTNNVIGVLTVTLAN
LSTILFTRLYFCLFSKRRFCWIFVFLFTTLSNALLLTTLNGILITPLFWY
YFGYVQTPNFLIVAEQYNKNTDFHFFFFGINNYWLGIFCLYSFFNLVKFG
LVSCFGVPIMRSFQKFYWKRALAK*
50
100
150
200
225
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1876C1266N279O297S9
Molecular weight (pH 7.5; Da) 26044.64 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
47035
Instability index 30.24
Is stable True
Aliphatic index 110.04
GRAVY (25C, pH 7.0) 0.848
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44