MG_517_MONOMER – glycosyl transferase, group 2 family protein

Name
WID MG_517_MONOMER View in model
Name glycosyl transferase, group 2 family protein View in model
 
Genetics
Gene MG_517 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MDKLVSILVPCYKSKPFLKRFFNSLLKQDLNQAKIIFFNDNVADETYEVL
QKFKKEHNNLAIEVYCDKQNEGIGKVRDKLVNLVTTPYFYFIDPDDCFNN
KNVIKEIVESIKKEDFDLGVLKSMVYLCFLKHDFIIKFLPLKGIFQGRVK
LINNNNVNKLNYIKNNDQYIWNIVINTDFFRKLNLTFESRLFEDIPIWYP
MFFSSQKIVFIDVIGTNYFIRNDSLSTTISAPRYLNLIQCYEKLYVNLSQ
NGSLASFIDPNHKIEARFWRRQMFVWFALFSFEYFKKNFSESKKILEKLF
VFLEKNGVYERVFQTKNQGIYYIWVQRLKYFKHVLESKSDN*
50
100
150
200
250
300
342
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2916C1911N472O507S9
Molecular weight (pH 7.5; Da) 40902.93 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
54945
Instability index 19.95
Is stable True
Aliphatic index 94.24
GRAVY (25C, pH 7.0) -0.223
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43