MG_516_MONOMER

Name
WID MG_516_MONOMER View in model
 
Genetics
Gene MG_516 View in model
 
Structure
Sequence
1
51
MNDLALALGLGIPLSLLVGMILGYFISIKIFKKQMRDNPPITENQIKAMY
AKMGRKLSETQVKEIMRSIKNQK*
50
74
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H634C373N99O100S6
Molecular weight (pH 7.5; Da) 8297.99 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
2980
Instability index 24.20
Is stable True
Aliphatic index 108.11
GRAVY (25C, pH 7.0) -0.0108
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43