MG_515_MONOMER

Name
WID MG_515_MONOMER View in model
 
Genetics
Gene MG_515 View in model
 
Structure
Sequence
1
51
101
151
201
251
LLKKKNQFDYLNLSHVLSKKKNSGGGWINKISDKLSEINVAEYQVVSKHS
NYLFYSRFGLLDTFVYFLFFLCFFLNNVLFLAGVFHTKQFTFNEVNGFNQ
FYLFWTVEKPTDIIQASITYQISQYGIANLVFGLISLALLVFLSFRWTVS
LFFKSQTTKWERIGYTTGFFISIVVYLLWILLMVLFLVLLDQQFFERDTQ
KIQSATRFSLFFNVENNNGVYLSKLNSFGVFATAWAISLVFYSFFFIAIF
AFNYNKTKLKQLFKKSKAK*
50
100
150
200
250
270
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2270C1523N350O378S2
Molecular weight (pH 7.5; Da) 31594.48 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
52495
Instability index 16.10
Is stable True
Aliphatic index 102.48
GRAVY (25C, pH 7.0) 0.361
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:42