MG_482_MONOMER – holo-(acyl-carrier-protein) synthase

Name
WID MG_482_MONOMER View in model
Name holo-(acyl-carrier-protein) synthase View in model
 
Genetics
Gene MG_482 View in model
 
Structure
Sequence
1
51
101
MVVGIGIDVVQLKRFLTLVETSDCFAKRLLTSNELNSYWKLNNNQRANFL
AVHWTLKEAIYKATSHIKPLFTKLEIYKLNNQYRCEFIQNINLLLSVSYT
NCHVSAICLAQQNG*
50
100
115
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H945C596N160O166S5
Molecular weight (pH 7.5; Da) 13168.14 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
18950
Instability index 12.89
Is stable True
Aliphatic index 107.65
GRAVY (25C, pH 7.0) 0.00870
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit holo-(acyl-carrier-protein) synthase
[c]: (2) MG_482_MONOMERMG_482_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 1 MG per monomer as prosthetic group [387].
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34