MG_481_MONOMER – 30S ribosomal protein S21

Name
WID MG_481_MONOMER View in model
Name 30S ribosomal protein S21 View in model
 
Genetics
Gene MG_481 View in model
 
Structure
Sequence
1
51
VPKIEVKNDDLELALKKFKRISLEVRRLAQRHEYHLRKGMRLREKQKIAQ
KKRRKFRSLASH*
50
63
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H591C338N113O85S1
Molecular weight (pH 7.5; Da) 7630.06 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
1490
Instability index 60.68
Is stable False
Aliphatic index 88.25
GRAVY (25C, pH 7.0) -1.12
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 30S ribosomal subunit
[c]: MGrrnA16S + MG_070_MONOMER + MG_087_MONOMER + MG_088_MONOMER + MG_090_MONOMER + MG_092_MONOMER + MG_150_MONOMER + MG_155_MONOMER + MG_157_MONOMER + MG_160_MONOMER + MG_164_MONOMER + MG_165_MONOMER + MG_168_MONOMER + MG_175_MONOMER + MG_176_MONOMER + MG_311_MONOMER + MG_417_MONOMER + MG_424_MONOMER + MG_446_MONOMER + MG_481_MONOMER + MG_522_MONOMERRIBOSOME_30S
View in model
 
Comments
Comments Functional Macromolecule Functional as part of 30S ribosomal particle.
 
Metadata
Created 2012-10-01 15:07:53
Last updated 2012-10-01 15:14:34