MG_478_MONOMER

Name
WID MG_478_MONOMER View in model
 
Genetics
Gene MG_478 View in model
 
Structure
Sequence
1
51
101
151
MTVYTYTVFLFNWENIGLMEQQNPDRLKKDRELIYAIVTAKGIISRFFWS
ILSFLITNLIFFFAAFVALLIYLLASVDNQFAFVFIAAIIFIIFYNIFFL
SYLLFIYFKGQKAIENNCKYLLTILDIKSDELLPFSLLGSLRKGYMLDEM
LLEQ*
50
100
150
155
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1322C878N189O217S5
Molecular weight (pH 7.5; Da) 18157.30 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
24535
Instability index 22.95
Is stable True
Aliphatic index 128.39
GRAVY (25C, pH 7.0) 0.758
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:50
Last updated 2012-10-01 15:14:30