MG_477_MONOMER

Name
WID MG_477_MONOMER View in model
 
Genetics
Gene MG_477 View in model
 
Structure
Sequence
1
51
MQLITRLCLLTRKHFVKRELLRLVKLDNQLEIDLNQNLKGRGYYLSVFGL
KLDKKHLKAVVEKHLKVSCNDAKLTAMITALQQLAQDEKK*
50
91
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H803C470N134O127S4
Molecular weight (pH 7.5; Da) 10491.45 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
3230
Instability index 17.01
Is stable True
Aliphatic index 118.90
GRAVY (25C, pH 7.0) -0.255
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29