MG_476_MONOMER – preprotein translocase, SecG subunit

Name
WID MG_476_MONOMER View in model
Name preprotein translocase, SecG subunit View in model
 
Genetics
Gene MG_476 View in model
 
Structure
Sequence
1
51
MHPIQIVMFIMAVICLIIGLLLSNHGSTGGLASLSGQDLEIFRKTKDRGF
VKILQIIMFILVVLFLILGLIFSFAPR*
50
78
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H660C404N97O95S5
Molecular weight (pH 7.5; Da) 8556.45 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
125
Instability index 33.36
Is stable True
Aliphatic index 152.44
GRAVY (25C, pH 7.0) 1.24
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit preprotein translocase
[m]: (4) MG_055_MONOMER + (4) MG_170_MONOMER + (4) MG_277_MONOMER + (4) MG_464_MONOMER + (4) MG_476_MONOMERMG_055_170_277_464_476_20MER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_055_170_476_12MER) [PUB_0203].
References
  1. Manting EH, van Der Does C, Remigy H, Engel A, Driessen AJ. SecYEG assembles into a tetramer to form the active protein translocation channel. EMBO J 19, 852-61 (2000). WholeCell: PUB_0203, PubMed: 10698927

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27