MG_474_MONOMER

Name
WID MG_474_MONOMER View in model
 
Genetics
Gene MG_474 View in model
 
Structure
Sequence
1
51
101
MKVFKKLHNLNEILLLISIFFLVCIISLVGIGIIFDLIRKASLSAIRSDP
IFFNLRAVLIVLGVFAICFMIIQLVISIMIWKTINTACENIEPKFKKILH
WSCFLPFGLLQLYCYQKIKLVKQADNL*
50
100
128
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1129C699N163O161S8
Molecular weight (pH 7.5; Da) 14648.91 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14605
Instability index 33.11
Is stable True
Aliphatic index 150.78
GRAVY (25C, pH 7.0) 1.03
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23