MG_470_MONOMER – CobQ/CobB/MinD/ParA nucleotide binding domain

Name
WID MG_470_MONOMER View in model
Name CobQ/CobB/MinD/ParA nucleotide binding domain View in model
 
Genetics
Gene MG_470 View in model
 
Structure
Sequence
1
51
101
151
201
251
MIISFVNNKGGVLKTTMATNVAGSLVKLCPERRKVILDLDGQGNVSASFG
QNPERLNNTLIDILLKVPKFSGSNNFIEIDDCLLSVYEGLDILPCNFELN
FADIDISRKKYKASDIAEIVKQLAKRYEFVLLDTPPNMATLVSTAMSLSD
VIVIPFEPDQYSMLGLMRIVETIDTFKEKNTNLKTILVPTKVNVRTRLHN
EVIDLAKTKAKKNNVAFSKNFVSLTSKSSAAVGYEKLPISLVSSPSKKYL
NEYLEITKEILNLANYNVH*
50
100
150
200
250
270
View in model
Is N‑terminal methionine cleaved
Yes
View in model
DNA footprint Length: 20 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H2193C1347N349O401S9
Molecular weight (pH 7.5; Da) 29981.42 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
12295
Instability index 25.97
Is stable True
Aliphatic index 106.81
GRAVY (25C, pH 7.0) -0.0270
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme Chromosome segregation (MraZ)
[c]: GTP + H2OGDP + H + PI
View in model
 
Parameters
Parameters Parameter_0042: gtpCost = 1 GTP View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0335]. ATP-dependent dimerization. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280]. DNA-binding Soj tetramers have 45 nt footprint [PUB_0735]. Soj dimers have 20 nt predicted footprint [PUB_0736]. ParA dimer has 150 nt footprint [PUB_0737].
References
  1. Davey MJ, Funnell BE. The P1 plasmid partition protein ParA. A role for ATP in site-specific DNA binding. J Biol Chem 269, 29908-13 (1994). WholeCell: PUB_0737, PubMed: 7961987

  2. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  3. Hester CM, Lutkenhaus J. Soj (ParA) DNA binding is mediated by conserved arginines and is essential for plasmid segregation. Proc Natl Acad Sci U S A 104, 20326-31 (2007). WholeCell: PUB_0736, PubMed: 18077387

  4. Leonard TA, Butler PJ, Löwe J. Bacterial chromosome segregation: structure and DNA binding of the Soj dimer--a conserved biological switch. EMBO J 24, 270-82 (2005). WholeCell: PUB_0335, PubMed: 15635448

  5. McLeod B. In vitro characterization of the ParA family protein Soj from bacillus subtilis. , (2008). WholeCell: PUB_0735, URL: http://hdl.handle.net/2429/5299

 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:53