MG_469_MONOMER – chromosomal replication initiator protein DnaA

Name
WID MG_469_MONOMER View in model
Name chromosomal replication initiator protein DnaA View in model
Cross references PDB: 2E0G, PDB: 2JMP
 
Genetics
Gene MG_469 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARN
SLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRDTLYQNSG
LSKNYTFQNFVISEGNKRAYEAGVRLAETQDNEFSPLFIYGETGLGKTHL
LQAIGNEKFRNFPNARVKYVVSSDFAQEVVDAFYQRDKGIEKLKKNYENL
DLVLIDDTQIFGRKEKTLEILFNIFNNLVLNKKQIVLVSDKAPDELIDID
ARMISRFKSGLLLKIEKHNLSSLCEILTVKLKEKDPNIQITNEARHDAAQ
ISGNDVRALNGIATKLLFFAKTSKQNLINTENLKEILFEEFEKFHKKSFD
PYLLIENVCRRFNVPMDSVLSENRKAELVRVRDVCNYLLRQKYNMQFQQI
GKIFKRSHSSVLMAVKRVAKMIENDSSLRDVITSLVI*
50
100
150
200
250
300
350
400
438
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3635C2288N618O668S9
Molecular weight (pH 7.5; Da) 50776.52 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
19745
Instability index 33.59
Is stable True
Aliphatic index 97.47
GRAVY (25C, pH 7.0) -0.360
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Reaction participant DnaA activation
[c]: ATP + MG_469_MONOMERMG_469_1MER_ATP
View in model
Complex subunit View in model
 
Comments
Comments Lowery et al determined the structure of the N-terminal domain of M. genitalium DnaA [PUB_0810]. Functional as monomer [PUB_0332].
References
  1. Carr KM, Kaguni JM. Stoichiometry of DnaA and DnaB protein in initiation at the Escherichia coli chromosomal origin. J Biol Chem 276, 44919-25 (2001). WholeCell: PUB_0332, PubMed: 11551962

  2. Lowery TJ, Pelton JG, Chandonia JM, Kim R, Yokota H, Wemmer DE. NMR structure of the N-terminal domain of the replication initiator protein DnaA. J Struct Funct Genomics 8, 11-7 (2007). WholeCell: PUB_0810, PubMed: 17680349

 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:53