MG_468_MONOMER – salivaricin A ABC transporter, permease protein

Name
WID MG_468_MONOMER View in model
Name salivaricin A ABC transporter, permease protein View in model
 
Genetics
Gene MG_468 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
1051
1101
1151
1201
1251
1301
1351
1401
1451
1501
1551
1601
1651
1701
1751
MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSIVQLSNNLVSTYTTL
VSKTNSSDIVAPAILKEANPVYIASLTNDSGYFSKIKIDDKKINYLFPYQ
ENDFGSDSGQSNGSGDNQNKTIPRKGDVNEKDKLFLARKRGILKAYGEAN
IAEKRIYKGLAVSFNNTDSFNGSDISDSITNRHIISDPQNLIYDASGNLL
GYFADGLIKETISLRAGIARFPGDKGKSTGTQVKITQKQQTNNDPQKDST
VNSLYKTNNKDKVWFKSDETKADNTDISANYLFTGGNEAANWFPNLYANI
PIDLEIDPGSQFWKDVNPFKEIVEEFQTQKESKDNQSFTLTFNLDISKLN
KLDNEQLKWLETNAKTIANNSSFGDWDLENKLKQLKKFELKINKDWLKKK
VESEKDTILNSLPGFSDSDKDTIFKTQNGMMVRNNNLSFQPSSNNLQLVQ
NQNSQASNGIADPNFSNVQTAYNKIHQSNNTPEKTLDAVYAAVLDQWRSI
FQEDLVKKTVDLLEKYRDHFLKATAFNNIDYSKQNIAIANNVSSAESASF
LVSNKDEQRYNDLSLIDGVDLKSWLFKPEQNESNPLDTIYGGQDANNGFL
QKIDYEFKPSTSSGGMTASLKNTQALSPKSTKFPIYPKLANIIAQAQLPE
ATNIPTTALDALKQWTNLDANGFNNLKEEDKRKAANNYLALLSYFTPAFQ
DPNELIETNRQMLEIPITVKNGVNPLILPTDQQNLVVQTPEAHGAVVSQQ
WLFRHNKEILPQEGEYAWKTALQTPNNFPNWLNDLPDRYKFSINGLTFAI
LGIGESVETGYPVLSLQSPLPNTQDEALIFVNDQAYRSILFAVPAANQEN
YYAFKSTDLKQHTDQDPVQFIANRLEGYLDVPRSDLAFNVKDISKFNYLT
TARNYFPDLVQSYLAIVSTVIAIFLIILALYLIILLIKSFIKKNQTEFSI
IRAGGFSTTKFIVGMSVFAGIVAIVSSFLGVLFAFLLEGQVKGIINRYWF
IALPENSFNWLSFFGSFFITFFVFEFISWIAFKQLFSKPVNVLIDQGNET
KFSVLLHLLKHKSHTMSPLTKFRVSLIVSRFSRLFTYVGLSSVALLLIGI
AGTIPQKFSAAQTSTSLNRNFNYKLNLQTPTEQSGWYAIQPYSHFGVTDN
NNGIKTLYNESVQANSQNEHPYKPSNLKLKNRQDQPIKAADGTELELGNL
LLPSYGGAQQLNTDENFFRHASLSKWIIDFPIRVGGSNINPWEIVEKSIP
KQITQLLSASSDQFLISVLTDDFFNNLNANGFLIRNPRTNQIQLDASRVL
TTIDVFNPGGVKFNDSFLSFMLKVYGDFELAKQDSKLNFGIVPVDPAIEE
TYTYVEGPFGFQEDNLDENSPYTLTGINPESSFVNLIDGSGNSLRNLISS
DQEMNVIVNAGFQYANNINIGDYVYIKPKNTATRYSEKFLKAPLNNSTVA
FKVVGVSTDAFGQELYINQHIANNLLKLSGNQGRGIIRDVIKKTNGQSQS
SDEYEIDYVKPNGYVPFNGVFSKELKPSLLNKALVLNSIIGVWGNFTDFG
NNFQNLVRNKLDKVITSILPTDPEIINKLAQEKQIINTTSMNYESLRKEL
VNKYKTEWNSVNLLSQNASSIFGNNIIAPVLNIDAAGTSAQIIRNNAEVL
FNTVNQVDAFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKAIGYRDVQ
NLISLLTFFIPAFVLALLISIGVLAGVLIGIQAVVFNVAQVFLTNVFEFL
PYMVGIVLFGVTIFVIGSYFWIKLRSAELKEGF*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1150
1200
1250
1300
1350
1400
1450
1500
1550
1600
1650
1700
1750
1784
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H14116C9122N2339O2698S14
Molecular weight (pH 7.5; Da) 200166.08 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
202045
Instability index 28.06
Is stable True
Aliphatic index 94.45
GRAVY (25C, pH 7.0) -0.180
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit salivaricin A ABC transporter
MG_467_MONOMER[c] + (2) MG_468_MONOMER[m] + MG_526_MONOMER[c] ⇒ MG_467_468_526_TETRAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_467_468_526_TETRAMER).
 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:53