MG_467_MONOMER – salivaricin A ABC transporter, ATP-binding protein

Name
WID MG_467_MONOMER View in model
Name salivaricin A ABC transporter, ATP-binding protein View in model
 
Genetics
Gene MG_467 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MKKGNKTVWNECIDILDNVKSPSFSANFDDYFKKSKSKPPKKNKKVLNNI
KKAELKLKKKANKKQKANTLYIPPFAQQAKGIVITINKMWKNVHNDDSKQ
EISILSDVSLQIAYGEIVIILGSSGSGKTTLLNLIGGYDSISLGSCIVAN
CPLEKCTSEQLLTYRKNNLGYVYQRYNLIELLSAYDNIAISQNLIPKYQR
RLDIEELAEKLDIKEILYKFPYEMSGGQKQRVAIARAIIKEPKLLLCDEP
TGALDSNSAENIINLLQTINKTYKQTILMVTHDVSLTRIANRIIKISDGK
IVSNQLVRPLV*
50
100
150
200
250
300
312
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2602C1572N422O461S9
Molecular weight (pH 7.5; Da) 35078.51 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
30995
Instability index 45.45
Is stable False
Aliphatic index 105.64
GRAVY (25C, pH 7.0) -0.309
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit salivaricin A ABC transporter
MG_467_MONOMER[c] + (2) MG_468_MONOMER[m] + MG_526_MONOMER[c] ⇒ MG_467_468_526_TETRAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_467_468_526_TETRAMER).
 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:53