MG_464_MONOMER – inner-membrane protein insertion factor

Name
WID MG_464_MONOMER View in model
Name inner-membrane protein insertion factor View in model
 
Genetics
Gene MG_464 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MPIKLAQTNKEIKTTFNPFWSAAVVNEKNNWKNFKKFSAIFIKVIKVFIF
IFLTIVGLWGCTQTLAQPWTGTNQVLGSGLEIGYKFGTTGDYRYDLISNN
FGPYFTFSDYTLAYGPFYGWFVWPAAQIVLPIMYATRVPLGSGVELGFNM
ILSLIVLLLLVRLITIVITLNSTLALEKMNEVQGKLAEINAKYKGAIDLQ
SKRNRQLEIMSLYKKHNIKSSAAFVQVFVTLPIFLIIYRIVTTLRPIKAI
ILFNFWDLSKVPLTEIFSNFTTTGWPFIIFLVIVLPVQFLSQKLPQVWAS
KRNENAKAHSQKSIEQLNKTKKMQLIFYFVFAAITAFSAAGVGVYWFLNA
LFTLLQSYLTHVFIVKRREKRKQNYSKLDLILERE*
50
100
150
200
250
300
350
386
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3266C2096N507O528S7
Molecular weight (pH 7.5; Da) 44239.76 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
77475
Instability index 33.54
Is stable True
Aliphatic index 110.36
GRAVY (25C, pH 7.0) 0.307
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit preprotein translocase
[m]: (4) MG_055_MONOMER + (4) MG_170_MONOMER + (4) MG_277_MONOMER + (4) MG_464_MONOMER + (4) MG_476_MONOMERMG_055_170_277_464_476_20MER
View in model
 
Comments
Comments Functional Macromolecule As a homodimer functions as an independent membrane protein insertase [PUB_0315]. Also associates with translocase secYE with 1:1 stochiometry [PUB_0006].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

  2. Kohler R, Boehringer D, Greber B, Bingel-Erlenmeyer R, Collinson I, Schaffitzel C, Ban N. YidC and Oxa1 form dimeric insertion pores on the translating ribosome. Mol Cell 34, 344-53 (2009). WholeCell: PUB_0315, PubMed: 19450532

 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:53