MG_463_MONOMER – dimethyladenosine transferase

Name
WID MG_463_MONOMER View in model
Name dimethyladenosine transferase View in model
Cross references PDB: 1QYR
 
Genetics
Gene MG_463 View in model
 
Structure
Sequence
1
51
101
151
201
251
VNSFFPSRKLGQNFTVNLSVIKRIFAFVKNLNPQAIVEIGVGKGALTNYL
LKLKIPYKGIEIDKRLIEYLLVEKILTEDQLVKGDILKKDFNSFFENLSP
LLCGNIPYSITSPIINKFLESKLRSFVLMTQKEFANRLLAKVNSSDYSAF
GAFCQYYLTITTVFKIDRHAFKPKPKVDSTLILLEKNKSVSYDFKFGLFL
KQCFNQRRKMLINNLKHFFAVDYLLNIIQKQNLKTSIRAQELSPCQLFNL
YQNICNGKN*
50
100
150
200
250
260
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2214C1386N353O369S7
Molecular weight (pH 7.5; Da) 29950.92 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
15525
Instability index 30.73
Is stable True
Aliphatic index 104.96
GRAVY (25C, pH 7.0) -0.0415
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0324].
References
  1. O'Farrell HC, Scarsdale JN, Rife JP. Crystal structure of KsgA, a universally conserved rRNA adenine dimethyltransferase in Escherichia coli. J Mol Biol 339, 337-53 (2004). WholeCell: PUB_0324, PubMed: 15136037

 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:53