MG_462_MONOMER – glutamyl-tRNA synthetase

Name
WID MG_462_MONOMER View in model
Name glutamyl-tRNA synthetase View in model
 
Genetics
Gene MG_462 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MEKIRTRYAPSPTGYLHVGGTRTAIFNFLLAKHFNGEFIIRIEDTDTERN
IKEGINSQFDNLRWLGVIADESVYNPGNYGPYLQSQKLAVYKKLAFDLIE
KNLAYRCFCSKEKLESDRKQAINNHKTPKYLGHCRNLHSKKITNHLEKND
PFTIRLKINNEAEYSWNDLVRGQITIPGSALTDIVILKANGVATYNFAVV
IDDYDMEITDVLRGAEHISNTAYQLAIYQALGFKRIPRFGHLSVIVDESG
KKLSKRDEKTTQFIEQFKQQGYLPEALLNFLALLGWHPQYNQEFFNLKQL
IENFSLSRVVSAPAFFDIKKLQWINANYIKQLTDNAYFNFIDNYLDVKVD
YLKDKNREISLLFKNQITHGVQINELIRESFATKIGVENLAKKSHILFKN
IKLFLEQLAKSLQGLEEWKAEQIKTTINKVGAVFNLKGKQLFMPIRLIFT
NKEHGPDLAHIIEIFDKESAINLIKQFINATNLF*
50
100
150
200
250
300
350
400
450
485
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H4003C2559N679O718S6
Molecular weight (pH 7.5; Da) 55960.51 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
56185
Instability index 29.36
Is stable True
Aliphatic index 97.15
GRAVY (25C, pH 7.0) -0.323
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0366, PUB_0367]. In E. coli associates with β-subunit which increases affinity for glutamate and ATP [PUB_0366]. Coenzymes Interacts with 2 MG or ZN per monomer as prosthetic group.
References
  1. Hara-Yokoyama M, Yokoyama S, Miyazawa T. Purification and characterization of glutamyl-tRNA synthetase from an extreme thermophile, Thermus thermophilus HB8. J Biochem 96, 1599-607 (1984). WholeCell: PUB_0367, PubMed: 6526823

  2. Kern D, Potier S, Boulanger Y, Lapointe J. The monomeric glutamyl-tRNA synthetase of Escherichia coli. Purification and relation between its structural and catalytic properties. J Biol Chem 254, 518-24 (1979). WholeCell: PUB_0366, PubMed: 368055

 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:53