MG_461_MONOMER – HD domain protein

Name
WID MG_461_MONOMER View in model
Name HD domain protein View in model
 
Genetics
Gene MG_461 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MQQTFFKDPILGEIIFDENTKWMYELVNTKAFQRLRNIKQLGINFHFYPS
GVHTRYAHSLGVYELIRRILNSSAFLNIDQIKKQTVLVAGLLHDLGHGPH
SHAFEIYFAKNPDFKKQLFIHEKVTSMLVNSEPIVSILKANKIDPNLIGA
LIDENQNIQPINWWMRQLISSDLDTDRMDYLLRDAYFTGTSHSLVDYQSI
INGMECVDNQGTYEIVFQEKCLPFIENFLITRHHMYQSIYSDGRSIATEL
NLWFVFQRIKALIEEDNFNFHNFKNVESVIKPLLKNQLFKKSLLTCFVKL
DDYVFHSFLVNTFETTKDAILKTLLDSYLNTLKFQVKFYESCEKRDLDFE
LKVKEYQTPSYFITKFNNQFKGFYEGWNKHKNELKIKTSQNKIKNLSEIS
MLVKRSNELFFENSFYRWANVFYQN*
50
100
150
200
250
300
350
400
426
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3528C2318N592O644S12
Molecular weight (pH 7.5; Da) 50377.03 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
61810
Instability index 36.75
Is stable True
Aliphatic index 89.67
GRAVY (25C, pH 7.0) -0.317
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:52