MG_460_MONOMER – L-lactate dehydrogenase/malate dehydrogenase

Name
WID MG_460_MONOMER View in model
Name L-lactate dehydrogenase/malate dehydrogenase View in model
Cross references PDB: 1F0X
 
Genetics
Gene MG_460 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MKGPKIAIVGSGAVGTSFLYAAMTRALGSEYMIIDINEKAKVGNVFDLQD
ASSSCPNFGKVVAGEYSQLKDYDFIFISAGRPQKQGGETRLQLLEGNVEI
MKSIAKEIKKSGFNGVTLIASNPVDIMSYTYLKVTGFEPNKVIGSGTLLD
SARLRYAIATKYQMSSKDVQAYVIGEHGDSSVSIISSAKIAGLSLKHFSK
ASDIEKEFGEIDQFIRRRAYEIIERKGATFYGIGEASADVAEQILKDTKE
VRVVAPLLTGQYGAKDMMFGTPCVLSRKGIEKILEIELSNTEKVALENSI
KVLKDNIKLAKL*
50
100
150
200
250
300
313
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2459C1518N399O460S10
Molecular weight (pH 7.5; Da) 33979.72 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
18130
Instability index 32.10
Is stable True
Aliphatic index 95.37
GRAVY (25C, pH 7.0) -0.0802
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit L-lactate dehydrogenase/malate dehydrogenase
[c]: (4) MG_460_MONOMERMG_460_TETRAMER
View in model
 
Comments
Comments First observed residue by mass-spec 0 [PUB_0280]. Functional Macromolecule Functional as homotetramer. Coenzymes Interacts with 1 MN per monomer as prosthetic group [387]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:52