MG_459_MONOMER – putative 2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase

Name
WID MG_459_MONOMER View in model
Name putative 2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase View in model
 
Genetics
Gene MG_459 View in model
 
Structure
Sequence
1
51
101
151
MQLRVGLGSKKYHIKLRKESKNKFWLGGVDFENSKYIYDLENSDEVSDVI
QLAVADALFGATALGDGHIVFNKGKSTVQFKGTAKKEAPRVLARTYNFIR
KNWIINNIDISLEIPQEQKVDDYKHAIFAFICSALRISELTINLKVRKPL
DSNEINCLAVVLVERQKTK*
50
100
150
170
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1400C869N237O248S3
Molecular weight (pH 7.5; Da) 19231.99 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
18700
Instability index 26.66
Is stable True
Aliphatic index 100.35
GRAVY (25C, pH 7.0) -0.261
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:52