MG_458_MONOMER – hypoxanthine phosphoribosyltransferase

Name
WID MG_458_MONOMER View in model
Name hypoxanthine phosphoribosyltransferase View in model
Cross references PDB: 1GRV
 
Genetics
Gene MG_458 View in model
 
Structure
Sequence
1
51
101
151
MGIKSIVINEQQIEEGCQKAVNWCNAKFNNKKVIVLGILKGCIPFLGKVI
SKFSFDLQLDFMAVASYHGSHVQKQPPKIVLDMSHDPKDKDILLIEDIVD
SGRSIKLVIDLLKTRHAKSITLISLIEKIKPKAFDINIDFSCFKVKDNFL
VGFGLDYDGFYRNLPYVGVFEPDNP*
50
100
150
176
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1436C908N228O250S7
Molecular weight (pH 7.5; Da) 19770.89 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
11960
Instability index 35.00
Is stable True
Aliphatic index 106.25
GRAVY (25C, pH 7.0) 0.0335
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit hypoxanthine phosphoribosyltransferase
[c]: (4) MG_458_MONOMERMG_458_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer. Coenzymes Interacts with 2 MG per monomer as prosthetic group [96,387].
 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:52