MG_457_MONOMER – ATP-dependent metalloprotease FtsH

Name
WID MG_457_MONOMER View in model
Name ATP-dependent metalloprotease FtsH View in model
Cross references PDB: 1LV7
 
Genetics
Gene MG_457 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
MKKRNKGLVEQTTTEKNNFSRKTAWKVFWWVIILAVVIGVLAYIFSPRAA
TAVVESWKLNGGSNSTLTAKVSGFSNELTFKQINGSTYVTDTILQVSITF
DGLNSPLTVTAHKTVNSNGNVIFNIANLSINQSNGQITVNSNGTMMNGGS
SNNTKSIAGFETLGTFIAPDTRARDVLNGLFGLLPIIIFVVFFLLFWRSA
RGISAGGREEDNIFSIGKTQAKLAKSTVKFTNIAGLQEEKHELLEIVDYL
KNPLKYAQMGARSPRGVILYGPPGTGKTLLAKAVAGEAGVPFFQSTGSGF
EDMLVGVGAKRVRDLFNKAKKAAPCIIFIDEIDSVGSKRGRVELSSYSVV
EQTLNQLLAEMDGFTSRTGVVVMAATNRLDVLDDALLRPGRFDRHIQINL
PDIKEREGILKVHAENKNLSSKISLLDVAKRTPGFSGAQLENVINEATLL
AVRDNRTTININDIDEAIDRVIAGPAKKSRVISDEDRKLVAYHEAGHALV
GLHVHSNDEVQKITIIPRGQAGGYTLSTPKSGDLNLKRKSDLLAMIATAM
GGRAAEEEIYGNLEITTGASSDFYKATNIARAMVTQLGMSKLGQVQYVPS
QGTLPSNVKLYSEQTAKDIDNEINFIIEEQYKKAKTIIKSNRKELELLVE
ALLIAETILKSDIDFIHKNTKLPPEILLQKQEQQAKQKLNKSEVKPESET
NS*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
703
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H5543C3412N944O1036S12
Molecular weight (pH 7.5; Da) 76749.78 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
46995
Instability index 34.09
Is stable True
Aliphatic index 96.97
GRAVY (25C, pH 7.0) -0.176
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit ATP-dependent metalloprotease FtsH
[m]: (6) MG_457_MONOMERMG_457_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer [PUB_0030]. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [PUB_0030, PUB_0096].
References
  1. Ito K, Akiyama Y. Cellular functions, mechanism of action, and regulation of FtsH protease. Annu Rev Microbiol 59, 211-31 (2005). WholeCell: PUB_0030, PubMed: 15910274

  2. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:52