MG_456_MONOMER

Name
WID MG_456_MONOMER View in model
 
Genetics
Gene MG_456 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MSDLTKFNKFFLTPNKLNAFLRVIGLCGLFSVIAISFGIYSYTRNEIPNI
ASLFLIVLGSVVLFLAFVIHFAALFKRNKLLKKVNKENRTNLWQKEMGNF
KAIESFEFFEQGPISSDILPSFYPTALYNFEPLPRQFKVTYKDGSEFVFG
HIYAIKRSSNKTEKVACLIAITPAINSENHFFLTDANYSLNKNVAQFEAL
TENKKQENISLFVEKDSNFSFQNLDTEVLNKVLFNPLNVYAKFNVYNDTV
HTYLFMSVPTTFMDTKLKVNEAFDDLVTNIKLQASYDFKTLNSMQKVVDL
LHNKLIKKPESKSSSQKSVETEIEKEVKDKLAKN*
50
100
150
200
250
300
335
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2747C1770N438O499S7
Molecular weight (pH 7.5; Da) 38370.73 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
22140
Instability index 41.56
Is stable False
Aliphatic index 91.64
GRAVY (25C, pH 7.0) -0.127
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:52