MG_455_MONOMER – tyrosyl-tRNA synthetase

Name
WID MG_455_MONOMER View in model
Name tyrosyl-tRNA synthetase View in model
Cross references PDB: 2YXN
 
Genetics
Gene MG_455 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MLNNILQFLKERELYSQANFETELDNHLKEKKNNFYVGFDPTANSLHIGN
YVLIHIAKLLKDMGHTPHIVLGSATALIGDPTGRIELRKILEEKEIVKNT
KTIKKQIKQFLGDVIIHENKVWLEKLNYIEVIRELGAFFSVNKMLSTDAF
SARWEKGLTLMELNYMILQAYDFYYLHKNHNVTLQIGGSDQWANILAGAN
LIKRKNNASVFGLTANLLVKANGEKMGKTSSGALWLDENKTSVFDFYQYW
INLDDQSLKKTFLMLTMLDKKVIDELCNLKGPKIKQTKQMLAFLITELIH
GTKKAKEAQQRSELIFSNQPDLDIKLVKTSTNLIDYLVETKFIKSKSEAR
RLISQKGLTINNKHVLDLNQIIEWKEELQIIRKGKKSFLTIKTVNS*
50
100
150
200
250
300
350
397
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3337C2070N546O587S10
Molecular weight (pH 7.5; Da) 45585.47 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
49515
Instability index 39.58
Is stable True
Aliphatic index 103.90
GRAVY (25C, pH 7.0) -0.287
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit tyrosyl-tRNA synthetase
[c]: (2) MG_455_MONOMERMG_455_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 1 MG per monomer as prosthetic group [387]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:08:04
Last updated 2012-10-01 15:14:52