MG_451_MONOMER – translation elongation factor Tu

Name
WID MG_451_MONOMER View in model
Name translation elongation factor Tu View in model
 
Genetics
Gene MG_451 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MAREKFDRSKPHVNVGTIGHIDHGKTTLTAAICTVLAKEGKSAATRYDEI
DKAPEEKARGITINSAHVEYSSDKRHYAHVDCPGHADYIKNMITGAAQMD
GAILVVSATDSVMPQTREHILLARQVGVPKMVVFLNKCDIASDEEVQELV
AEEVRDLLTSYGFDGKNTPIIYGSALKALEGDPKWEAKIHDLIKAVDEWI
PTPTREVDKPFLLAIEDTMTITGRGTVVTGRVERGELKVGQEVEIVGLKP
IRKAVVTGIEMFKKELDSAMAGDNAGVLLRGVERKEVERGQVLAKPGSIK
PHKKFKAEIYALKKEEGGRHTGFLNGYRPQFYFRTTDVTGSIALAENTEM
VLPGDNASITVELIAPIACEKGSKFSIREGGRTVGAGTVTEVLE*
50
100
150
200
250
300
350
395
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3064C1897N529O581S13
Molecular weight (pH 7.5; Da) 42994.54 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
24910
Instability index 26.49
Is stable True
Aliphatic index 88.13
GRAVY (25C, pH 7.0) -0.274
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit translation elongation factor Tu
[c]: (2) MG_451_MONOMERMG_451_DIMER
View in model
 
Comments
Comments 17% observed in membrane in M. pneumoniae [286]; Functional Macromolecule Functional as homodimer [PUB_0368, PUB_0369]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Ehrenberg M, Rojas AM, Weiser J, Kurland CG. How many EF-Tu molecules participate in aminoacyl-tRNA binding and peptide bond formation in Escherichia coli translation?. J Mol Biol 211, 739-49 (1990). WholeCell: PUB_0368, PubMed: 2179565

  2. Jiang Y, Nock S, Nesper M, Sprinzl M, Sigler PB. Structure and importance of the dimerization domain in elongation factor Ts from Thermus thermophilus. Biochemistry 35, 10269-78 (1996). WholeCell: PUB_0369, PubMed: 8756682

  3. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:51