MG_449_MONOMER – conserved hypothetical protein, authentic frameshift

Name
WID MG_449_MONOMER View in model
Name conserved hypothetical protein, authentic frameshift View in model
 
Genetics
Gene MG_449 View in model
 
Structure
Sequence
1
51
101
151
201
MFDISKDFVSIFYRKETLKNCMFGIIGSRSETTLRQQNDKDWSFFVNDAN
RITGFNFFNIKKSFKKFFYHTALMKV*TILH*K*WKE*VSF*VMILFH*Q
IKFLLLFVKLFQLFLLQTPI*KGVKLTLVWQKAWILFVELIMLELVWKQF
*YK*VECYLAVQLSKKLK*LVLIQLACYVLKKNLI*NRKMRV*LRLILRS
K*ENHLLMYI*INNIPNE*IPKKEWSWA
50
100
150
200
228
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1909C1226N300O273S10
Molecular weight (pH 7.5; Da) 25539.70 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
47815
Instability index 29.63
Is stable True
Aliphatic index 107.24
GRAVY (25C, pH 7.0) 0.189
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:51