MG_447_MONOMER – multidrug efflux pump

Name
WID MG_447_MONOMER View in model
Name multidrug efflux pump View in model
 
Genetics
Gene MG_447 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
VNSKRDRFEKQLLIKNVFESKQLFLTILRFTVPTFFFALFSAAYVFIDQI
MVIKFVPRSELNPDSIFTDQSLIDEFKNSAFYKSDSFLSSGLNIKQFIKT
VLNISQPLIVLLNAINIFIPLGTGVIFSKAIGRNDQNKIQEAWNTGLIST
TVFGLITQFLVLSFAKEWLHYNLDQSSFEQNFQANSFQQFFNKKAIDVAS
EYVYILIGLNIIPMLSRLFFYLAQSEGRQLFIAIVPPIANLINILIVFLL
VRYSSLGVIGSAVAGILGYLINFLAYIIYLIYLNKRNLTYLTFKTIKLNK
IDFNLLVVVSLIGMASFFRNGSLSIVTTFYESFLVNLTKATTDKNDVFYL
TLLTGPIAISNLASAAIFGLLQGVRTVSSYKFGQKKYDEIKKINIYTVII
CISFGSLIYLLTAVAFGKQILSSFFDVSDQNLDLANYFSLIVQAQVFFVA
TGANSQQYFQNTNRVLYSWIVSLTHGLFVFIPLLFIFQAITLQTNNIEVF
IWLLTANAALAGLINIAFGQIHTNLFMDKYFANPPQNKLVKFIEKYS*
50
100
150
200
250
300
350
400
450
500
548
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4534C2935N692O773S5
Molecular weight (pH 7.5; Da) 62041.72 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
56395
Instability index 35.73
Is stable True
Aliphatic index 120.80
GRAVY (25C, pH 7.0) 0.531
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Enzyme View in model
 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:51