MG_442_MONOMER – ribosomal biogenesis GTPase

Name
WID MG_442_MONOMER View in model
Name ribosomal biogenesis GTPase View in model
 
Genetics
Gene MG_442 View in model
 
Structure
Sequence
1
51
101
151
201
251
MDTYTSAKINWFPGHMKKIHDQLKKLSSQIDGIIEIVDARAPTLTHNSEI
ISYFLNKPKLILALKTDLAQYKPNKKILFGSLKEPFKLKKKVLKTLTTLF
ANKRQQLKAKGLLIKQFRLAVIGMPNVGKSSLINLLINKNHLKVANRAGI
TKSLNWIQISPELLLSDTPGVFLKRIDEIQIGYKLVLTNVIRREVVNIEE
VGMFAFNYLKKHYKQLLPFEADSFINFLEKFAKVRGLIKKANELNTNLAC
EIFINELINGKYGKLSYELN*
50
100
150
200
250
271
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2340C1428N372O378S5
Molecular weight (pH 7.5; Da) 30928.36 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
23045
Instability index 29.53
Is stable True
Aliphatic index 113.36
GRAVY (25C, pH 7.0) -0.106
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme Ribosome assembly (RbgA)
[c]: GTP + H2OGDP + H + PI
View in model
 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50