MG_441_MONOMER

Name
WID MG_441_MONOMER View in model
 
Genetics
Gene MG_441 View in model
 
Structure
Sequence
1
51
101
MSVSFLRSKFSLKASVFAFFVLFLFCLKIILVLFRNFGKRFKHFLFNQTS
LYLLVRLFQKTEIVWNLIANIHFFIKTQIQNLGIRLSRESISNETFQAVK
LFHVNNLGLQEQEVINSKLSDYFCFFKYRNLLFVNW
50
100
136
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1198C781N193O186S3
Molecular weight (pH 7.5; Da) 16363.20 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
15720
Instability index 29.33
Is stable True
Aliphatic index 113.16
GRAVY (25C, pH 7.0) 0.420
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50