MG_438_MONOMER – type I restriction modification DNA specificity domain protein

Name
WID MG_438_MONOMER View in model
Name type I restriction modification DNA specificity domain protein View in model
Cross references PDB: 1YDX
 
Genetics
Gene MG_438 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MTPKLKLNNNINWTKRTIDSLFDLKKGEMLEKELITPEGKYEYFNGGVKN
SGRTDKFNTFKNTISVIVGGSCGYVRLADKNFFCGQSNCTLNLLDPLELD
LKFAYYALKSQQERIEALAFGTTIQNIRISDLKELEIPFTSNKNEQHAIA
NTLSVFDERLENLASLIEINRKLRDEYAHKLFSLDEAFLSHWKLEALQSQ
MHEITLGEIFNFKSGKYLKSEERLEEGKFPYYGAGIDNTGFVAEPNTEKD
TISIISNGYSLGNIRYHEIPWFNGTGSIALEPMNNEIYVPFFYCALKYLQ
KDIKERMKSDDSPFLSLKLAGEIKVPYVKSFQLQRKAGKIVFLLDQKLDQ
YKKELSSLTVIRDTLLKKLFPDMTERTKSIKDY*
50
100
150
200
250
300
350
384
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
DNA footprint Length: 14 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H3131C2000N514O589S10
Molecular weight (pH 7.5; Da) 44120.88 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
42330
Instability index 30.50
Is stable True
Aliphatic index 87.89
GRAVY (25C, pH 7.0) -0.436
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
Reaction participant View in model
 
Parameters
Parameters View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0097]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group. Stable modifications Phosphorylation observed by mass-spec [PUB_0094]. DNA-binding Consensus motif TTANNNNNNNGTCY is 14 bp [PUB_0542].
References
  1. Calisto BM, Pich OQ, Piñol J, Fita I, Querol E, Carpena X. Crystal structure of a putative type I restriction-modification S subunit from Mycoplasma genitalium. J Mol Biol 351, 749-62 (2005). WholeCell: PUB_0097, PubMed: 16038930

  2. Murray NE. Type I restriction systems: sophisticated molecular machines (a legacy of Bertani and Weigle). Microbiol Mol Biol Rev 64, 412-34 (2000). WholeCell: PUB_0542, PubMed: 10839821

  3. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50