MG_437_MONOMER – phosphatidate cytidylyltransferase

Name
WID MG_437_MONOMER View in model
Name phosphatidate cytidylyltransferase View in model
 
Genetics
Gene MG_437 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MNEKAKQFIKKRTSVFIALLVVFCFFLLISAFADGFNFWSPWSADFNSRT
LKVEQASGVTSVISTEINENFKAVRFSFSIIIILIVGVIGSLMIWELFTN
ILKNKPKLSLSLTLLNAGIIIFGMIGTFVVVYFYKWNATVNGIWTLSFTL
SVVLLWIIYIACMSKTRIKFSLQLSYSLGAIACFIASIGTIYFSVIRGWT
TIFLLMSLAVSVDTFSFLFGKRFGKNPLIKISPSKTWEGAFFGIISTIVV
VALLCVLYSIPFFVAKPTFNQTNGIALNTPQNYDSHNLITNIFLIAFISG
GSSFYIYWWVSTLALIFTGSVFAIGGDLFFSYIKRLISIKDFSKVLGKHG
GVLDRFDSSSFLISFFFVYHLIAGTISNQRLLMEPNTYFSAITSIQS*
50
100
150
200
250
300
350
398
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups
  • (None) K [c]

View in model
Empirical formula (pH 7.5) H3250C2123N487O537S10
Molecular weight (pH 7.5; Da) 44507.98 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
73380
Instability index 23.97
Is stable True
Aliphatic index 116.33
GRAVY (25C, pH 7.0) 0.782
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit phosphatidate cytidylyltransferase
[m]: (2) MG_437_MONOMERMG_437_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0370]. Coenzymes Monomer interacts with MG or K with unknown stoichiometry as prosthetic group.
References
  1. Weber CH, Park YS, Sanker S, Kent C, Ludwig ML. A prototypical cytidylyltransferase: CTP:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis. Structure 7, 1113-24 (1999). WholeCell: PUB_0370, PubMed: 10508782

 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50