MG_435_MONOMER – ribosome recycling factor

Name
WID MG_435_MONOMER View in model
Name ribosome recycling factor View in model
Cross references PDB: 2RDO
 
Genetics
Gene MG_435 View in model
 
Structure
Sequence
1
51
101
151
MTKAHYIDFFKQAADKKIQWLKEELTKIRTGRPNPKIFDNLLIESYGQKM
PLISLAQVTINPPREIIIKPFDPKSNTNAIYSEIQRANIGVQPVIDGEKI
RVNFPQITQETRLENIKHVKKIIEQIYQELRVVRRDALQMIKKDNHNEDL
ENSLKAEIEKINKNYSNQLEEIQKDKEKELLTI*
50
100
150
184
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1576C964N266O284S3
Molecular weight (pH 7.5; Da) 21532.57 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
12950
Instability index 46.81
Is stable False
Aliphatic index 98.04
GRAVY (25C, pH 7.0) -0.704
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0227].
References
  1. Toyoda T, Tin OF, Ito K, Fujiwara T, Kumasaka T, Yamamoto M, Garber MB, Nakamura Y. Crystal structure combined with genetic analysis of the Thermus thermophilus ribosome recycling factor shows that a flexible hinge may act as a functional switch. RNA 6, 1432-44 (2000). WholeCell: PUB_0227, PubMed: 11073219

 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50