MG_434_MONOMER – uridylate kinase

Name
WID MG_434_MONOMER View in model
Name uridylate kinase View in model
Cross references PDB: 2BNF
 
Genetics
Gene MG_434 View in model
 
Structure
Sequence
1
51
101
151
201
MHKSNNKIRQRIIIKLSGAGLTKENSQPFSNDFFETIINQLKVLKESYQV
GIVIGGGNIIRGNNCQEFNIAEYHGHQLGIIATVVNGYFLKAKLDAHNLK
SALLSAISCPSLAVQILSQQTIDKAFEENDFVIFSGGTGNPYFSTDTALA
LRAVQTKAVAILIGKNGVDGVYTADPKKDKNATFLPTLNYDHAIKNDLKI
MDITAFTMCKENNLKIIIFNINAENALLDALNKKGRFTIIENN*
50
100
150
200
244
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1922C1199N324O355S6
Molecular weight (pH 7.5; Da) 26748.36 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
9315
Instability index 24.11
Is stable True
Aliphatic index 101.60
GRAVY (25C, pH 7.0) -0.0766
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit uridylate kinase
[c]: (6) MG_434_MONOMERMG_434_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer.
 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50