MG_433_MONOMER – translation elongation factor Ts

Name
WID MG_433_MONOMER View in model
Name translation elongation factor Ts View in model
Cross references PDB: 1EFU
 
Genetics
Gene MG_433 View in model
 
Structure
Sequence
1
51
101
151
201
251
MATKIELIKELRKSTQASVMDCKQALEKNNDDFEKAVKWLRENGIVKSTK
KLNKVASEGIIVLKSNLHKAIMVEINSQTDFVAKNQELKEFSDLMLEKIF
EKVNPKTELVEIEKIQINNDEKVSEKLALIASKTDEKIVLRRVVVFETKT
NQIFTYLHANKRIGVIIEIQGKLNEDDGKHLAMHIAANSPQFIDQSDVNQ
TWLQNERNIIRSQAELEVKENPKKAIFLEKTIEGRVNKLLIDTCLINQKY
LIDETKTIGQFLKEKQAKVLKFIRYEVGEGIIKETVDFVSEVNAQIKQ*
50
100
150
200
250
299
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H2524C1529N413O460S7
Molecular weight (pH 7.5; Da) 34277.25 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
15720
Instability index 32.45
Is stable True
Aliphatic index 103.65
GRAVY (25C, pH 7.0) -0.411
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit translation elongation factor Ts
[c]: (2) MG_433_MONOMERMG_433_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0371, PUB_0372]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Blank J, Nock S, Kreutzer R, Sprinzl M. Elongation factor Ts from Thermus thermophilus-- overproduction in Escherichia coli, quaternary structure and interaction with elongation factor Tu. Eur J Biochem 236, 222-7 (1996). WholeCell: PUB_0371, PubMed: 8617268

  2. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  3. Nesper M, Nock S, Sedlák E, Antalík M, Podhradský D, Sprinzl M. Dimers of Thermus thermophilus elongation factor Ts are required for its function as a nucleotide exchange factor of elongation factor Tu. Eur J Biochem 255, 81-6 (1998). WholeCell: PUB_0372, PubMed: 9692904

 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50