MG_432_MONOMER – membrane protein, putative

Name
WID MG_432_MONOMER View in model
Name membrane protein, putative View in model
 
Genetics
Gene MG_432 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MKDKNIKISGNFVRIHLSGSFLKFQSIYNLKKLYLQLVILTIVAFFWGLL
GVIFVQFSGLYDIGMASISQGLARLVNFFITSQNINVDSATIFNAIFWLT
QILFNVPFFIFGWFKISKKFTLLTLYFVAVSNLFGFFFSYIPGIDNFFLF
ANLTTAKDGGFENLINEKGVQLIFWEKSAEKQVSLLFYGLIWGFLQAVFY
SVILIIDASTGGLDFLAFWYSEKKYKDIGGILMLINTVSFIIGYVIGTYL
TGSLSVQSYVGDDKHQPFGVAFFLSPNLVFTLLMNIVLGLFTSFYFPKYQ
FVKVEVYGKHIEKIRNYLLDNQQWFSITMFEAEGGYSRQKTQVLVTNCLL
IKAAKLLEDVRKFDRDALFSITFIKKLDGYIYDRRTNKQTKHGTENKS*
50
100
150
200
250
300
350
399
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3300C2183N505O558S6
Molecular weight (pH 7.5; Da) 45738.87 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
66935
Instability index 27.68
Is stable True
Aliphatic index 107.94
GRAVY (25C, pH 7.0) 0.395
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50