MG_431_MONOMER – triosephosphate isomerase

Name
WID MG_431_MONOMER View in model
Name triosephosphate isomerase View in model
Cross references PDB: 1TRE
 
Genetics
Gene MG_431 View in model
 
Structure
Sequence
1
51
101
151
201
MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIAPVYVHLTEIK
KIISDSLLLFAQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYY
NETSAVINQKLFACLKASMQVVLCIGEALGQEISFLKTDLTNCLDTIDKS
LIKNLVIAYEPLWAIGTGKTATPEVANQTIKTIREYINDLYDENVANNIS
ILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMARVYA*
50
100
150
200
245
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1952C1229N321O369S7
Molecular weight (pH 7.5; Da) 27352.96 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
27765
Instability index 26.87
Is stable True
Aliphatic index 104.69
GRAVY (25C, pH 7.0) -0.0608
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit triosephosphate isomerase
[c]: (2) MG_431_MONOMERMG_431_DIMER
View in model
 
Comments
Comments First observed residue by mass-spec 13 [PUB_0280]. Functional Macromolecule Functional as homodimer.
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:08:03
Last updated 2012-10-01 15:14:50