MG_430_MONOMER – 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

Name
WID MG_430_MONOMER View in model
Name 2,3-bisphosphoglycerate-independent phosphoglycerate mutase View in model
 
Genetics
Gene MG_430 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
MHKKVLLAILDGYGISNAIYGNAVQNANTPMLDELINSYPCVLLDASGEA
VGLPMGQIGNSEVGHLNIGAGRVVYTGLSLINQHIKDRSFFANKAFLKTI
EHVEKNHSKIHLIGLFSNGGVHSHNEHLLALIELFSKHAKVVLHLFGDGR
DVAPCSLKQDLEKLMIFLKNYPNVVIGTIGGRYYGMDRDQRWDREMIAYK
ALLGVSKNKFNDPIGYIETQYQNQITDEFIYPAINANLNSDQFALNNNDG
VIFFNFRPDRARQMSHLIFNSNYYNYQPELKRKENLFFVTMMNYEGIVPS
EFAFPPQTIKNSLGEVIANNNLKQLRIAETEKYAHVTFFFDGGFEVNLSN
ETKTLIPSLKVATYDLAPEMSCKAITDALLEKLNNFDFTVLNFANPDMVG
HTGNYQACIKALEALDVQIKRIVDFCKANQITMFLTADHGNAEVMIDNNN
NPVTKHTINPVPFVCTDKNVNFNQTGILANIAPTILEYLNLSKPKEMTAK
SLLKNNN*
50
100
150
200
250
300
350
400
450
500
508
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3979C2560N684O747S20
Molecular weight (pH 7.5; Da) 56931.26 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
34560
Instability index 25.99
Is stable True
Aliphatic index 93.11
GRAVY (25C, pH 7.0) -0.179
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme phosphoglycerate mutase
[c]: G3PG2P
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0373, PUB_0374]. Coenzymes Interacts with 2 MN per monomer as prosthetic group [96].
References
  1. Johnsen U, Schönheit P. Characterization of cofactor-dependent and cofactor-independent phosphoglycerate mutases from Archaea. Extremophiles 11, 647-57 (2007). WholeCell: PUB_0374, PubMed: 17576516

  2. Johnson CM, Price NC. Do metal ions promote the re-activation of the 2,3-bisphosphoglycerate-independent phosphoglycerate mutases?. Biochem J 252, 111-7 (1988). WholeCell: PUB_0373, PubMed: 2844142

 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:49