MG_428_MONOMER – LuxR bacterial regulatory protein, putative

Name
WID MG_428_MONOMER View in model
Name LuxR bacterial regulatory protein, putative View in model
 
Genetics
Gene MG_428 View in model
 
Structure
Sequence
1
51
101
151
MKNNISDVKLGLLAAKIYWKSWRFLELTEDDIISIALHAEQDSKKRFNPE
FGLSFDNYLKLNGANFIRSSFRSMVNKVELLDSKSKYSLEKQNTVLNTPE
NYLRSLEFKEIITKAFNKAKNDQERKVFSLYVKGYKNFEIAKKLNISPRR
VRYLLDLFKSYIKLLTERYGY*
50
100
150
172
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1474C930N244O259S2
Molecular weight (pH 7.5; Da) 20281.20 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
25900
Instability index 36.06
Is stable True
Aliphatic index 91.28
GRAVY (25C, pH 7.0) -0.518
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit LuxR bacterial regulatory protein, putative
[c]: (2) MG_428_MONOMERMG_428_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0209].
References
  1. Nasser W, Reverchon S. New insights into the regulatory mechanisms of the LuxR family of quorum sensing regulators. Anal Bioanal Chem 387, 381-90 (2007). WholeCell: PUB_0209, PubMed: 16953322

 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:49