MG_427_MONOMER – osmotically inducible peroxidase

Name
WID MG_427_MONOMER View in model
Name osmotically inducible peroxidase View in model
 
Genetics
Gene MG_427 View in model
 
Structure
Sequence
1
51
101
MDKKYDITAVLNDDSSINAVSDNFQITLDARPKEKSKGINPLSAFLAGLA
ACELATANAMAAAKMITLNKALINIKGYRLTNPSDGYFGLRELNIHWEIH
SPNEEEEIKEFIDFVSKRCPAHNTLHGTSNFKINISVTLVH*
50
100
142
View in model
Is N‑terminal methionine cleaved
No
View in model
Disulfide_bonds MG_427_DIMER_ox: 52-119 View in model
Empirical formula (pH 7.5) H1095C693N189O211S5
Molecular weight (pH 7.5; Da) 15610.53 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
10220
Instability index 41.56
Is stable False
Aliphatic index 92.18
GRAVY (25C, pH 7.0) -0.217
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit osmotically inducible peroxidase
[c]: (2) MG_427_MONOMERMG_427_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0141]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Jenkins C, Geary SJ, Gladd M, Djordjevic SP. The Mycoplasma gallisepticum OsmC-like protein MG1142 resides on the cell surface and binds heparin. Microbiology 153, 1455-63 (2007). WholeCell: PUB_0141, PubMed: 17464059

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:49