MG_425_MONOMER – ATP-dependent RNA helicase

Name
WID MG_425_MONOMER View in model
Name ATP-dependent RNA helicase View in model
 
Genetics
Gene MG_425 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MDSTFHELGISQTLIETLNALHINKPTKIQQISIPQFLSEKNLIVHSPTG
TGKTAAFAIPIIEKLLKEDQTAKPTLVIAPTRELVEQIKTTFSNIAKNKK
LRIISLIGGVPAWKQIKKIKTNPQIIVGTMGRIMDLLERKAIHFSDLEHL
IIDEVDLMLDRGFKKQIFNLLEQINSFKQIAVYSASYNQEAINIAKQITN
NGIFIGSPEFNKDANTNNDKLIKQFVCYLFSDQKKQALYSLIKTAQVKSI
IVFCDTKKLVDDLHVFLRKNELRTFALHGDKKQFIRERNLKIFANTKQPT
ILVTTDLIGRGIHVEAIDMVINYSACLNLEAYINRMGRTGRNNHKGTCVT
FCTSQEKKVFLKMVEKITDNRIAECKQMEIKLIPLKNKAKTKKGGISLDC
VQKIYANAKPYDRNKRVPLASDLFKSRMRQPEKAMQKQKIHDNDWQSNM*
50
100
150
200
250
300
350
400
450
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3783C2297N634O652S18
Molecular weight (pH 7.5; Da) 51290.49 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
23795
Instability index 31.32
Is stable True
Aliphatic index 97.76
GRAVY (25C, pH 7.0) -0.311
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit ATP-dependent RNA helicase
[c]: (2) MG_425_MONOMERMG_425_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0071]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [71].
References
  1. Rauhut R, Klug G. mRNA degradation in bacteria. FEMS Microbiol Rev 23, 353-70 (1999). WholeCell: PUB_0071, PubMed: 10371038

 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:49