MG_422_MONOMER

Name
WID MG_422_MONOMER View in model
 
Genetics
Gene MG_422 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
MLKKISLFDNLEQWVDLSLLMIRTSFLDANYFGVAKLSLFKYGNYLIDNL
NQAQWKTLSQVLQLNKQPYSGFLLVNNHQYLPLQKIKFNLCEEIDLRNKN
KWLFPNSFSIFLKQDLSYKKDQNYFNLVNIPKQLKWFLGFNALNDLFRFS
ILKIENVNQKTSKVINQFFTSKFINSIYFEQVDFEYNNFLTLIEKNEREL
VDFNCMFFNQLFTFNNKVIKSFFERYYALNEQKNNLKNKLKIAAYEAKSR
DNSYFEKLQIERAKQRLFDAKKTFSKQHKNALQLINSFTFSLIFSGWKIK
WRSFFNFYRKRILEKKIVSKRIKTRILLLKEIKKMDLLSPKLLVETIDES
INLVNKIFANIQNLYQEIISLKSGPNLNWKYQTINQELKIMSARFILTKK
EVHEFLIKARLSFIKNFVKQSNNLYVHEKLVNELKENILLNQNHYRGKHN
NSFSVLIQKTVFKQFIDTVQYAIGLISMRKSLETFNFAFQIKQYFYESLL
ANYQKINWQKYELNNLYFVLISLWNSLSKKFQQFFNKYEFLSCGSNDFIW
NEGRSEPHFSLLKDKLKNDLNSPKWNFLVDKVINKYLDLNFETPVSFLLA
SRGFSSTTDTTNKETKNDLKQKLKKCKQKYKLLLKDINLVKWIFRDETNQ
KLQKIKFIMKRYCILNKTLHLRLKKTNKKIKRTFFIDSEECNINRLEASN
KLYLNVLNSQLKTINFFLRSQKNLKKLNFINNINLLINQTKKNGISSWML
FSDLNKINKNESLKLYLLFKLLLNPKLLMINCCNDFTNHAYNFIRGLLIS
YQNKQGIALIFNDPNNKLVKNFSIKNIDFETGMKK*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
836
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H7309C4631N1197O1232S18
Molecular weight (pH 7.5; Da) 100042.74 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
120180
Instability index 30.34
Is stable True
Aliphatic index 97.72
GRAVY (25C, pH 7.0) -0.377
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:49