MG_421_MONOMER – excinuclease ABC, A subunit

Name
WID MG_421_MONOMER View in model
Name excinuclease ABC, A subunit View in model
 
Genetics
Gene MG_421 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
LTLKPEWKNNDFIRVKGARENNLKNINIDIPKNQFVVITGLSGSGKSSLA
FNTIYAEGRRRYLESLSSYARQFLGNSDKPDVDLIEGLSPAISIDQKTTS
HNPRSTVGTVTEIYDYLRLLWARIGTPYCPNGHGSIQTQTINQIANQIFD
LPNKSKVQLLAPTVKNQRGIFTNEFIKYKQLGFLRVLVDGQIYTLDDEIK
LDKNTKHNISVVIDRIIINKDNQTYSRIVDSIETIDRLTNGKIEVLKEDG
TILNFSKNHGCDKCGFSISELEPRLFSFNSPLGSCSYCKGLGFSYEPDVD
KIIADSKLSINQGAIDIFKNIVHGTSLDWQRFLSLVNHYKIPLDKPIEQL
DKSQLNLILEGSDEPIEIKTISNSGAKNIRFEHYEGIANLIKRRHLETNS
QVSREWYSAYMSEITCKKCHGKKLIKDALSVKLGGIDIISFTELSIDKSI
DFLLKLELNDEQKKIGELALKEIINRLSFLKNVGLDYLNLARRASTLSGG
EAQRIRLATQIGSQLTGVLYVMDEPSIGLHQKDNMRLIKTMMVMRDLGNT
LLVVEHDSETMLAADYLIDIGPKAGNEGGELVACGTPLQVMENSNSITGQ
YLSGKKQISIPKNRHSGNGKTIIIKGAKVNNLKNINVTIPLNKLVLITGV
SGSGKSSLINQTLVPALERILYRKGVKKDTYKEIIGANNIDKIIVVSQDP
IGRTPRSNPATYISVFDDIRDLFANTKEAKARGYTNSRFSFNVPGGRCDK
CFGDGVIRIEMHFLPDVYVKCEVCNGKKYNSQTLEIKYLGKSIFDVLQMS
CKEAYEFFKAIPNISRKLRLLCDVGLEYLQLGINVTFLSGGEAQRIKLSK
FLQKKSTGKTLFVLDEPSTGLHLEDINKLLTIIQRIIKNGDTVVVIEHNL
DIIKVADYIIDLGPEGGDNGGQIVAQGTPEQLINQVNKSYTAQYLSKILK
PDSI*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
955
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H7702C4749N1296O1425S24
Molecular weight (pH 7.5; Da) 106523.05 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
69940
Instability index 27.84
Is stable True
Aliphatic index 102.16
GRAVY (25C, pH 7.0) -0.251
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DNA incision complex
[c]: MG_073_MONOMER + MG_206_MONOMER + (2) MG_421_MONOMERMG_073_206_421_TETRAMER
View in model
 
Comments
Comments 2 Zn2+ ions bind per monomer [PUB_0461]. First observed residue by mass-spec 15 [PUB_0280]. Functional Macromolecule Functional as hetercomplex (see MG_073_206_421_TRIMER).
References
  1. Friedberg EC, Walker GC, Siede W, Wood RD, Schultz RA, Ellenberger T. DNA repair and mutagenesis. ASM Press (2006). WholeCell: PUB_0461, ISBN: 9781555813192

  2. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:49