MG_419_MONOMER – DNA polymerase III, subunit gamma and tau

Name
WID MG_419_MONOMER View in model
Name DNA polymerase III, subunit gamma and tau View in model
Cross references PDB: 2AYA
 
Genetics
Gene MG_419 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MHQVFYQKYRPINFKQTLGQESIRKILVNAINRDKLPNGYIFSGERGTGK
TTFAKIIAKAINCLNWDQIDVCNSCDVCKSINTNSAIDIVEIDAASKNGI
NDIRELVENVFNHPFTFKKKVYILDEAHMLTTQSWGGLLKTLEESPPYVL
FIFTTTEFNKIPLTILSRCQSFFFKKITSDLILERLNDIAKKEKIKIEKD
ALIKIADLSQGSLRDGLSLLDQISNFSDSEKISITDVEKTFNIVDRNAKF
TFIKAVLSGDIKEAFNLLDDFESNGLNFTYFLRELFALTVNLYAYAKLKN
INVLDSTEKTMIETLNFEKQHYAFLIKAIEENTNFGLSQLTLIDRLKAIV
ISYNEFFNQKPLTISSPSNEKSLHLETEYLEKKKIKKSNHKQDQKHFSLF
EKSFIDKSEKTPKNDEVTNNKFLDTSKLNLANIALAINAFNDNKWINHFQ
NLLSVFQTKFNDKDKQNNLSYFNNFIDKYSARDIVKATKIVKASSFGIVI
LFEDQKIAMRLWKEAIEEGNVQATIFQIFNQNLFLASFSEHQYKTTITEE
TKNQKYQTEVLNLTQLENLAKPFLKEKKRSLSQKMVDKYFKGLFEEK*
50
100
150
200
250
300
350
400
450
500
550
598
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4946C3139N808O921S10
Molecular weight (pH 7.5; Da) 69060.17 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
46465
Instability index 28.23
Is stable True
Aliphatic index 92.16
GRAVY (25C, pH 7.0) -0.365
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DNA-directed DNA polymerase gamma complex
[c]: MG_007_MONOMER + MG_315_MONOMER + (4) MG_419_MONOMERDNA_POLYMERASE_GAMMA_COMPLEX
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see DNA_POLYMERASE_GAMMA_COMPLEX) [PUB_0312, PUB_0313, PUB_0314].
References
  1. Bruck I, O'Donnell M. The DNA replication machine of a gram-positive organism. J Biol Chem 275, 28971-83 (2000). WholeCell: PUB_0314, PubMed: 10878011

  2. Kelman Z, O'Donnell M. DNA polymerase III holoenzyme: structure and function of a chromosomal replicating machine. Annu Rev Biochem 64, 171-200 (1995). WholeCell: PUB_0312, PubMed: 7574479

  3. Razin S, Yogev D, Naot Y. Molecular biology and pathogenicity of mycoplasmas. Microbiol Mol Biol Rev 62, 1094-156 (1998). WholeCell: PUB_0313, PubMed: 9841667

 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:49