MG_412_MONOMER – phosphate ABC transporter, substrate-binding protein

Name
WID MG_412_MONOMER View in model
Name phosphate ABC transporter, substrate-binding protein View in model
 
Genetics
Gene MG_412 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
VLKFRNFFKLTLLTLASAFFLSGCANINLISAVGSSSVQPLLNKLSSYYV
LNENNDNDKLVEISVQAGGSNAGIRAIINGFADIGNVSKNPKEYAKENEK
KWRDKKLKTLTIGKDAIAVIYKAPQELKGKLLLTKDNINDLYDLFAGVKT
INIDKFVKKDTKNMSNEKDYPLTSFPRTGGSFASGTAEAFLNFSALKSDK
TLDSQTRDILKGIINYGPLAKPTSETNIEAFNTFVTNLQDPNLFGMIYLS
LGFIQNNLQAIKNNGFEILPIKYENKEVLPSNQTVSQNEYKWVRPLNSIV
SLSEENKNIDEIKTFFNWLFFNGKKDVIKNIYDEFGILQLTEDEKKKMFK
TNDSSPMNLENFWVDDFAFSNPIFGAF*
50
100
150
200
250
300
350
378
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 32 (nt) View in model
Empirical formula (pH 7.5) H3015C1932N490O574S5
Molecular weight (pH 7.5; Da) 42450.75 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
38515
Instability index 29.88
Is stable True
Aliphatic index 89.02
GRAVY (25C, pH 7.0) -0.310
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Function
Complex subunit phosphate ABC transporter
(2) MG_410_MONOMER[c] + (2) MG_411_MONOMER[m] + MG_412_MONOMER[e] ⇒ MG_410_411_412_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_410_411_412_PENTAMER). Signal Peptipde Signal peptide of length 23 (SPdb335573, MLKFRNFFKLTLLTLASAFFLSG) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:48