MG_411_MONOMER – phosphate ABC transporter, permease protein PstA

Name
WID MG_411_MONOMER View in model
Name phosphate ABC transporter, permease protein PstA View in model
 
Genetics
Gene MG_411 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
VQKKIKKRLKKENLLRIFSKTLAFLFLVLFISFFVFLLTEATKIGPDFAK
SLFNLEFNLGNKQAGIWFPLLVSFIVSIGALIIASYIGVRTSFFLVYRCK
PKIRKKLSLIIDILSGIPSVIFGLFASQILSIFFRDILKLPPLSLLNVIA
MLSFMIIPIVISLTTNTLTYVNNDLISVVVSLGENKTSAIYKIIKKEIKP
QLTVILTLAFARAISETMAVNFVLQSVNYQEVINNNRFFTSDLKTLGSVI
STFIFSENGDEQINGVLYIFGIIILILVSLLNFFAIWSANPKTLERYPFL
KKISNFIYQVVWFIPNNISALFVDLTSTRQSVKKIKVNNINERSLFFKER
LQSVVWIKLNYFLKIFQELICTFLAFGFVLAILLFVFINGSVAINNNGST
VFSFEADSTGRALVNTLVIILITITITFPLALLIAIWLNEYNNSKVVKNV
FNFVIDSLSSMPSIIYGLFGLSFFLRVLQLSAGGANGTSLIAGILTISVV
ILLFLIRTCQQALNNVSWDLRISAFALGISKREVIFKIVLPSALKGLIVA
LILSINRIIAETAPFFITSGLSSSNLFHLSLPGQTLTTRIYGQLFSINSN
AISVMLETSLVSVVFLILLIFFSSYLIPSLFLLNKQKWLVIKSKFQSFKL
WKRT*
50
100
150
200
250
300
350
400
450
500
550
600
650
655
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5577C3491N826O885S8
Molecular weight (pH 7.5; Da) 73535.94 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
63745
Instability index 24.95
Is stable True
Aliphatic index 136.73
GRAVY (25C, pH 7.0) 0.790
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit phosphate ABC transporter
(2) MG_410_MONOMER[c] + (2) MG_411_MONOMER[m] + MG_412_MONOMER[e] ⇒ MG_410_411_412_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_410_411_412_PENTAMER).
 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:48